Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 236 bits (603), Expect = 4e-67 Identities = 125/294 (42%), Positives = 187/294 (63%), Gaps = 3/294 (1%) Query: 15 LILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVGSILGAA 74 L+++ +V+ L T FLT N+ + VS AI++ GMT VI+T GIDLSVG ++ + Sbjct: 38 LVVVTLVMILASDT--FLTASNLSNIARQVSINAIIAVGMTCVILTGGIDLSVGPVMALS 95 Query: 75 SVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGMLSVGRGLAY 134 + LM GL P L++ G+ +GV FG+ NGL + + P I TL + + RGL Sbjct: 96 GTLTAGLM-VAGLPPGLAIGAGMLIGVAFGIGNGLFVAYLHMPPIIVTLATMGIARGLGL 154 Query: 135 VMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGRRIYAIGGNM 194 + + G+PIS P+ F G+ + + VP++ M + ++A++ L++T GR IYAIGGN Sbjct: 155 MYTDGYPISGLPDWFAFFGRESLFGIQVPILIMLLTYLVAYVLLQHTRIGRYIYAIGGNE 214 Query: 195 EASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQGYELDVIAATVIGGT 254 EA +L G++ R +LVY I+G AA AG +LT+ L QPNAG +ELD IAA V+GG Sbjct: 215 EAVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQPNAGVSFELDAIAAVVLGGA 274 Query: 255 SLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIAIDQIR 308 S++GG G I+G LGA+++GVL NG+ +LGVS + Q V+ G +I++AI I + R Sbjct: 275 SIAGGRGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQSVIKGGIILLAIFISRQR 328 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 330 Length adjustment: 28 Effective length of query: 285 Effective length of database: 302 Effective search space: 86070 Effective search space used: 86070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory