Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate GFF2202 PS417_11230 hydroxyacid dehydrogenase
Query= BRENDA::Q38707 (365 letters) >FitnessBrowser__WCS417:GFF2202 Length = 355 Score = 331 bits (848), Expect = 2e-95 Identities = 171/345 (49%), Positives = 232/345 (67%), Gaps = 5/345 (1%) Query: 12 KAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPG 71 K + +AA++ L PF F RRA G DV++ +L+CGVCHSD H N W T YP VPG Sbjct: 3 KTYSYAAQNAKDSLKPFTFERRAPGADDVQIDILYCGVCHSDLHTARNEWNNTLYPSVPG 62 Query: 72 HEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTI-DTYGSIYFD 130 HEIVG VT VG+ V KVGD G+GC+V SC+ C SC + E +CEN TY F Sbjct: 63 HEIVGRVTAVGTNVSTFKVGDLAGVGCMVDSCQHCASCAEGEEQYCENGFTGTYNGPVFG 122 Query: 131 GTMTHGGYSDTMVADEHFILRWP-KNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGV 189 G T GGYSD++V E F+LR + L + APLLCAGITTYSPL ++ + PG K+GV Sbjct: 123 GENTFGGYSDSIVVKEKFVLRISHDDSNLAAVAPLLCAGITTYSPLHHWKVG-PGKKVGV 181 Query: 190 VGLGGLGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGARSSLD 249 VGLGGLGH+AVK+A A GA VT+ S +KR++ L +LGAD +++ + ++M +SLD Sbjct: 182 VGLGGLGHMAVKIAHAMGAHVTLFTTSPNKREDGL-RLGADQVVVSKNPDEMAKVANSLD 240 Query: 250 GIIDTVPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELP-VFSLLKGRKLLGGTINGGIKE 308 I++TV H L +LLK +G + +VGAP+ P P VF+L+ R+ L G++ GGI+E Sbjct: 241 FILNTVAAPHNLDAFLNLLKRDGTMTLVGAPDSPHPSPTVFNLIFKRRGLAGSLIGGIQE 300 Query: 309 TQEMLDFAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVIDI 353 TQ+MLDF A+H I +D+E+I + +N A ER++K DV+YRFVID+ Sbjct: 301 TQDMLDFCARHGIVSDIEMIDIQGINEAYERMLKGDVKYRFVIDM 345 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 355 Length adjustment: 29 Effective length of query: 336 Effective length of database: 326 Effective search space: 109536 Effective search space used: 109536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory