Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate GFF1903 PS417_09690 sugar dehydrogenase
Query= SwissProt::Q8NK50 (266 letters) >FitnessBrowser__WCS417:GFF1903 Length = 266 Score = 132 bits (331), Expect = 1e-35 Identities = 92/263 (34%), Positives = 140/263 (53%), Gaps = 27/263 (10%) Query: 16 SLKGKVVVVTGASGPRGMGIEAARGCAEMGADLAITYSSRKEGAEKNAEELTKEYGVKVK 75 SL+ +V +VTGAS G+G AA+ A+ GA + + Y+S+ AE AE++ E G + Sbjct: 4 SLEQQVALVTGASS--GIGAGAAKALAQAGAAVVLNYNSQAAPAEALAEQINAEGGRAIA 61 Query: 76 VYKVNQSDYNDVERFVNQVVSDFGKIDAFIANAGATANSGVVDGSASDWDHVIQVDLSGT 135 + N S +DVE Q + FG +D +AN+G ++ +VD S DW+ VI V+L+G Sbjct: 62 I-GANVSKEDDVESLFAQTLDAFGHLDILVANSGMQKDANLVDMSLDDWNAVIGVNLTGQ 120 Query: 136 AYCAKAVGAHFKKQG--------HGSLVITASM------SGHVANYPQEQTSYNVAKAGC 181 CA+A F +QG G ++ +S+ +GHV +Y +K G Sbjct: 121 FLCARAAVRIFNRQGVREGVSRAAGKIIHMSSVHQLIPWAGHV--------NYAASKGGV 172 Query: 182 IHLARSLANEWRD-FARVNSISPGYIDTGLSDFIDE-KTQELWRSMIPMGRNGDAKELKG 239 L R+LA E + R+N I+PG I T ++ E Q+ +IP GR GD +++ Sbjct: 173 EMLMRTLAQEVSEQRIRINGIAPGAIRTAINRAATEGAAQKELLKLIPYGRVGDVEDVAN 232 Query: 240 AYVYLVSDASSYTTGADIVIDGG 262 A V+L SDAS Y G+ + IDGG Sbjct: 233 AVVWLASDASDYVVGSTLFIDGG 255 Lambda K H 0.314 0.131 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 266 Length adjustment: 25 Effective length of query: 241 Effective length of database: 241 Effective search space: 58081 Effective search space used: 58081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory