Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate GFF2363 PS417_12050 short-chain dehydrogenase
Query= SwissProt::O93868 (262 letters) >FitnessBrowser__WCS417:GFF2363 Length = 251 Score = 100 bits (250), Expect = 2e-26 Identities = 85/253 (33%), Positives = 121/253 (47%), Gaps = 25/253 (9%) Query: 15 IVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGK-EFGVKTKAYQCDVSNT 73 ++TGG GIGLA + GA VA++ R VEV +G G+ D+ Sbjct: 17 VITGGAAGIGLACASLLVERGARVALLDRDPA-VVEVAAGLGAGHLGIAV-----DLGQI 70 Query: 74 DIVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRAVAK 133 + TI + A + LI +AGV ++ A +++ + D+N+ F +A A+ Sbjct: 71 GQIQHTIDTVFAHFQRLDYLINSAGVVLLDKAVDVSESAWDTTLDINLKASFFVAQACAR 130 Query: 134 LWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIR 193 L Q G IV + +Q+++ G V Y +SKAA + K LA EWA I Sbjct: 131 HMLA-QGSGRIV-------NLASQAAVIGLDRHVAYCASKAAIVGMTKVLAMEWAPQ-IN 181 Query: 194 VNALSPGYVNTDQTAHMDKK-----IRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYM 248 VNA+SP V T + KK + + IP RFAQPEE+ G A+ LLSD A + Sbjct: 182 VNAISPTIVETA----LGKKAWAGEVGEKAKLQIPAGRFAQPEEIAGLALYLLSDAAQMI 237 Query: 249 TGGEYFIDGGQLI 261 TG IDGG I Sbjct: 238 TGANMVIDGGYSI 250 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 251 Length adjustment: 24 Effective length of query: 238 Effective length of database: 227 Effective search space: 54026 Effective search space used: 54026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory