Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate GFF2674 PS417_13640 ribose ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__WCS417:GFF2674 Length = 325 Score = 324 bits (830), Expect = 2e-93 Identities = 177/326 (54%), Positives = 232/326 (71%), Gaps = 11/326 (3%) Query: 17 ARRSSSTTAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAIN 76 A + + A+ L+ +GMLPVL+ LL G L + NF + +N I +Q ++N Sbjct: 7 ATTNKAERARELMRTVGMLPVLI---LLLVGFAL-----ASENFLTMQNLSIISQQASVN 58 Query: 77 LVLAAGMTFVILTAGIDLSVGSVLAVSAVLGMQVSLGAAPG-WAIPMFIFSGLVMGMVNG 135 +VLAAGMTFVILTAGIDLSVG++LA SAV+ +Q S+ G + I I GL++G+VNG Sbjct: 59 VVLAAGMTFVILTAGIDLSVGAILAASAVVALQASMSPQFGMFGIAAGIGFGLLLGLVNG 118 Query: 136 AMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGDFLHVPWLIWVA 195 ++A + + F+VTLG +TA RG A LLAD TV N D+P F +IGN L VPWL+ +A Sbjct: 119 GLIAFMRLPPFIVTLGALTAMRGLARLLADDKTVFNPDLP-FAFIGNDSLLGVPWLVIIA 177 Query: 196 VAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSA 255 VAVV LSW ILR+TV+G+ IY++GGN +AARL+GI+V VLLFVY++SG +GL MSA Sbjct: 178 VAVVALSWFILRRTVMGVQIYSVGGNPEAARLSGIKVWKVLLFVYAMSGALAGLGAVMSA 237 Query: 256 SRLYGANG-NWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLS 314 SRL+ ANG G YELDAIAAV+LGGTS GGVG+I GT++GALII V+ NGL +LG+S Sbjct: 238 SRLFAANGLQLGQSYELDAIAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVS 297 Query: 315 SFWQYVAKGAVIVLAVILDKWRQKDA 340 WQY+ KG VI+ AV LD++RQ A Sbjct: 298 DIWQYIIKGIVIIGAVALDRYRQSGA 323 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 325 Length adjustment: 28 Effective length of query: 316 Effective length of database: 297 Effective search space: 93852 Effective search space used: 93852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory