Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate GFF2332 PS417_11890 D-ribose transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >FitnessBrowser__WCS417:GFF2332 Length = 517 Score = 150 bits (380), Expect = 4e-41 Identities = 89/248 (35%), Positives = 141/248 (56%), Gaps = 9/248 (3%) Query: 3 QEP-ILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEG 61 +EP +L + K + V AL + PG +LA++G+NGAGKS+++K I+G PD G Sbjct: 19 EEPYLLEIVNISKGFPGVVALADVQLRVRPGTVLALMGENGAGKSTLMKIIAGIYQPDAG 78 Query: 62 EIRLEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSL 121 EIRL GKPI F +P+ A++AGI ++Q L L P +SIA+N+++GRE M R + Sbjct: 79 EIRLRGKPIVFETPLAAQKAGIAMIHQELNLMPHMSIAENIWIGREQLNSLHMVN-HREM 137 Query: 122 DRAAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAA 181 R E AR +++ + + V LS +RQ V +A+A ++ S ++IMDEPT+A Sbjct: 138 HRCTAELLARLRIN-------LDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSA 190 Query: 182 LGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMS 241 + KE + +I D++ +G IV I+H M VF +AD + + R G + + Sbjct: 191 ITEKEVAHLFSIIADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHYIGLQRADSMNSD 250 Query: 242 DAVAFMTG 249 ++ M G Sbjct: 251 SLISMMVG 258 Score = 96.7 bits (239), Expect = 9e-25 Identities = 60/226 (26%), Positives = 112/226 (49%), Gaps = 9/226 (3%) Query: 27 FDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRLEGKPIQFRSPMEARQAGIETV 86 FDL+ GEIL + G G+G++++ + I G G+I L+GK ++ P A + G + Sbjct: 293 FDLHAGEILGIAGLMGSGRTNVAETIFGITPSSSGQITLDGKAVRISDPHMAIEKGFALL 352 Query: 87 YQNLALS---PALSIADNMFLGREIRKPGIMGKWFRSLDRAAMEKQARAKLSELGLMTIQ 143 ++ LS P LS+ +NM + P G F + + A+ +L + T Sbjct: 353 TEDRKLSGLFPCLSVLENMEMAV---LPHYTGNGF--IQQKALRALCEDMCKKLRVKT-P 406 Query: 144 NINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRVLELILDVRRRGLP 203 ++ Q ++TLSGG +Q +AR +++I+DEPT + V + LI + G+ Sbjct: 407 SLEQCIDTLSGGNQQKALLARWLMTNPRLLILDEPTRGIDVGAKAEIYRLIAFLASEGMA 466 Query: 204 IVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMSDAVAFMTG 249 +++IS +P V ++DR+ + G + ++ + T + +G Sbjct: 467 VIMISSELPEVLGMSDRVMVMHEGELMGTLDRSEATQEKVMQLASG 512 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 260 Length of database: 517 Length adjustment: 30 Effective length of query: 230 Effective length of database: 487 Effective search space: 112010 Effective search space used: 112010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory