Align Fructose import permease protein FrcC (characterized)
to candidate GFF2674 PS417_13640 ribose ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__WCS417:GFF2674 Length = 325 Score = 188 bits (477), Expect = 2e-52 Identities = 112/304 (36%), Positives = 177/304 (58%), Gaps = 11/304 (3%) Query: 52 LIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMV 111 L VL+L L+ F + F + +++I QQ ++ ++ A T VILTAGIDLSVGAI+ Sbjct: 25 LPVLILLLVGFA-LASENFLTMQNLSIISQQASVNVVLAAGMTFVILTAGIDLSVGAILA 83 Query: 112 LSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLAS 171 S+V+ Q + F + G+G G L G +NG L+A M+LPPFIVTLG + Sbjct: 84 ASAVVALQASMSPQFG-MFGIAAGIGFGLLLGLVNGGLIAFMRLPPFIVTLGALTAMRGL 142 Query: 172 NFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAWG 231 L + ++T+ D+ F G + +G + V++ V +V L W++L RT G Sbjct: 143 ARLLADDKTVFNPDLP-----FAFIGNDSLLG---VPWLVIIAVAVVALSWFILRRTVMG 194 Query: 232 RYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTA-GQFANI 290 +Y+VG +PEAA+L+G+ V ++L+ +Y +SG + L R+ + + GQ + Sbjct: 195 VQIYSVGGNPEAARLSGIKVWKVLLFVYAMSGALAGLGAVMSASRLFAANGLQLGQSYEL 254 Query: 291 ESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVA 350 ++I AV++GG S GG G+I G L GALI+ V + GL L+G W Y++ G++II AVA Sbjct: 255 DAIAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGIVIIGAVA 314 Query: 351 IDQW 354 +D++ Sbjct: 315 LDRY 318 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 325 Length adjustment: 29 Effective length of query: 331 Effective length of database: 296 Effective search space: 97976 Effective search space used: 97976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory