Align Inositol transport system sugar-binding protein (characterized)
to candidate GFF2364 PS417_12055 sugar ABC transporter substrate-binding protein
Query= reanno::WCS417:GFF2331 (309 letters) >FitnessBrowser__WCS417:GFF2364 Length = 335 Score = 162 bits (409), Expect = 1e-44 Identities = 104/303 (34%), Positives = 166/303 (54%), Gaps = 18/303 (5%) Query: 1 MKTPIRFTALALSMLLASGVASAAD---LKIGVSMSAFDDTFLTYLREDMDKQAKSYP-- 55 MK A A LLA +A AAD K+G ++ F+ ++ ++ K +P Sbjct: 1 MKLGTTLAATAALSLLACSIAMAADGKTYKVGAAVYGLKGQFM----QNWVRELKEHPAV 56 Query: 56 KGDGVQLQFEDARADVVKQLSQVENFISQKVDAIIVNPVDTASTANIIKAATAAKIPLVF 115 K VQL D D + Q +Q+EN ++Q+ DAI+ P+DT + +KAA + + ++ Sbjct: 57 KDGTVQLTVFDGNYDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIA 116 Query: 116 VNRRPDSQTLAPGVAAVTSDDVEAGKLQMQYIAEKLGGKGNIVILLGDLANNSTTNRTKG 175 N ++ V V +DDVE G+LQ Q + +KL GKGN+VI+ G + ++ +R KG Sbjct: 117 SN----TKVADASVPYVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQGPIGQSAQIDREKG 172 Query: 176 VKEVLTKYPGIKIEQEQTGIWLRDRGMTLVNDWL-TQGRDFQAVLSNNDEMAIGAAMALK 234 EVL K+P IKI +++T W R + + L DWL + V++ ND+MA+GA ALK Sbjct: 173 ELEVLGKHPDIKIIEKKTANWDRAQALALTEDWLNAHPKGINGVIAQNDDMALGAVQALK 232 Query: 235 SAG--KKGVLIAGVDGTPDGLNAITKGDMTVSAFQDAKGQADKSVETA-RKMAKNEPIEQ 291 S G K V + +DG PD + A K ++T + QDA+ Q+ +++ A R +A + Q Sbjct: 233 SHGLTSKDVPVTSIDGMPDAIQAAKKDEVT-TFLQDAQAQSQGALDVALRALAGKDYKPQ 291 Query: 292 NVV 294 +V+ Sbjct: 292 SVI 294 Lambda K H 0.314 0.131 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 335 Length adjustment: 28 Effective length of query: 281 Effective length of database: 307 Effective search space: 86267 Effective search space used: 86267 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory