GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_11890 in Pseudomonas simiae WCS417

Align m-Inositol ABC transporter, ATPase component (itaA) (characterized)
to candidate GFF2366 PS417_12065 D-ribose transporter ATP-binding protein

Query= reanno::pseudo3_N2E3:AO353_21385
         (521 letters)



>lcl|FitnessBrowser__WCS417:GFF2366 PS417_12065 D-ribose transporter
           ATP-binding protein
          Length = 495

 Score =  402 bits (1032), Expect = e-116
 Identities = 220/492 (44%), Positives = 313/492 (63%), Gaps = 1/492 (0%)

Query: 25  PYLLEIINVSKGFPGVVALSDVQLRVRPGSVLALMGENGAGKSTLMKIIAGIYQPDAGEL 84
           P LL+  +V+K + GV AL D +L +R GSV AL G NGAGKST + I+ GI Q DAG +
Sbjct: 4   PLLLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSI 63

Query: 85  RLRGKPVTFDTPLAALQAGIAMIHQELNLMPHMSIAENIWIGREQLNGFHMIDHREMHRC 144
            L G PV F+ P  AL AGIAMI QEL  +P+M++AENIW+GRE      ++D++ ++R 
Sbjct: 64  LLNGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRR 123

Query: 145 TAQLLERLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSAITDKEVAHLF 204
           T +LL+ L  ++D    +  LS+A+ Q+VEIAKA S+D  ++IMDEPTSAI + E   LF
Sbjct: 124 TRELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLF 183

Query: 205 SIIADLKAQGKGIIYITHKMNEVFSIADEVAVFRDGAYIGLQRADSMDGDSLISMMVGRE 264
             I  L AQG GI+Y++H+++E+  IAD+ ++FRDGA++   R   +D D L+  +VG+E
Sbjct: 184 KAIRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQE 243

Query: 265 LSQL-FPVREKPIGDLLMSVRDLRLDGVFKGVSFDLHAGEILGIAGLMGSGRTNVAEAIF 323
           L+++   V  +   +  + V +L   G F  +S  L  GEILGI GLMGSGR+     I+
Sbjct: 244 LTRIDHKVGRECAANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIY 303

Query: 324 GITPSDGGEICLDGQPVRISDPHMAIEKGFALLTEDRKLSGLFPCLSVLENMEMAVLPHY 383
           G+T +D G + L G+P+ I  P   I  G +L+TEDRK SGL    S+L N+ ++     
Sbjct: 304 GLTVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNIALSAYKRL 363

Query: 384 AGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKALLARWLMTNPRILILD 443
           +    I  +    L EDM K+L++KT SLE  + ++SGGNQQK +LA+ L T P  L+ D
Sbjct: 364 SSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLLCD 423

Query: 444 EPTRGIDVGAKAEIYRLISYLASEGMAVIMISSELPEVLGMSDRVMVMHEGDLMGTLDRS 503
           EPTRGID GAK EIY L+      G A I++SSE PE+L +SDR+ V   G L+     +
Sbjct: 424 EPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVTISTDT 483

Query: 504 EATQERVMQLAS 515
             +QE +++LAS
Sbjct: 484 ALSQEALLRLAS 495


Lambda     K      H
   0.321    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 594
Number of extensions: 26
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 521
Length of database: 495
Length adjustment: 34
Effective length of query: 487
Effective length of database: 461
Effective search space:   224507
Effective search space used:   224507
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory