Align Inositol 2-dehydrogenase; EC 1.1.1.18; Myo-inositol 2-dehydrogenase; MI 2-dehydrogenase (uncharacterized)
to candidate GFF2963 PS417_15165 1-carboxy-3-chloro-3,4-dihydroxycyclo hexa-1,5-diene dehydrogenase
Query= curated2:C5BYN4 (360 letters) >FitnessBrowser__WCS417:GFF2963 Length = 371 Score = 71.6 bits (174), Expect = 3e-17 Identities = 59/201 (29%), Positives = 90/201 (44%), Gaps = 18/201 (8%) Query: 5 IGVVGPGGMGRAHI-----DRITGELAGGA-VVAVHDIDEVNARRVAEPIG-AKVFGSAT 57 IG++G G MGRAH R EL + A+ D D A+R A+ G A+ G Sbjct: 6 IGLIGTGFMGRAHALAFNNARAVFELPVHLKLAALADADTERAQRCAKAWGFAQAHGDWQ 65 Query: 58 ELVASDAVDAVLVASDGTAHLEPVLAAVAAGKPVLCEKPLAPTAAECEQVMAAEVAAGRR 117 L+ VD V + + H +AA+AAGK V CEKPLA + + + + A AAG Sbjct: 66 ALINDPNVDVVAITTPNHLHYPMAMAAIAAGKAVYCEKPLAVSLEQADAMRRAASAAG-V 124 Query: 118 LVTIGFMRRFDASYLAMKAVLDGGELGEALLVHCRHRNPSAR----------EAYRATMA 167 + +G+ + + + ++ GGELGE + E A A Sbjct: 125 VTRVGYNYQHNPMITLARQMIAGGELGEIISFQGEFSEDFMADSASPWSWRCEVEHAGGA 184 Query: 168 ITDTAIHEIDAMRWLLGEEIA 188 + D H + R+LLG+ ++ Sbjct: 185 LADLGSHLLSMARYLLGDVVS 205 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 371 Length adjustment: 30 Effective length of query: 330 Effective length of database: 341 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory