GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mmsA in Pseudomonas simiae WCS417

Align malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18); methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate GFF4637 PS417_23725 methylmalonate-semialdehyde dehydrogenase

Query= BRENDA::Q02252
         (535 letters)



>lcl|FitnessBrowser__WCS417:GFF4637 PS417_23725
           methylmalonate-semialdehyde dehydrogenase
          Length = 505

 Score =  604 bits (1557), Expect = e-177
 Identities = 289/490 (58%), Positives = 374/490 (76%)

Query: 31  SSFSSSVPTVKLFIGGKFVESKSDKWIDIHNPATNEVIGRVPQATKAEMDAAIASCKRAF 90
           +S   SV  VKL I G++VESK+ +W DI NPAT EV+ +VP AT  E++AAI +  RAF
Sbjct: 3   ASADISVQQVKLLINGEWVESKTTEWQDIVNPATQEVLAKVPFATADEVNAAIDAAHRAF 62

Query: 91  PAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACS 150
             W  T + +R +++L+ Q LI+E+ K IA +++ EQGKT+ADAEGD+FRGL+VVEHACS
Sbjct: 63  QTWKLTPIGARMRIMLKLQALIREHSKRIAVVLSNEQGKTIADAEGDIFRGLEVVEHACS 122

Query: 151 VTSLMMGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKP 210
           + +L MGE   ++   +D Y+ R P+GVCAGI PFNFPAMIPLWMFPMA+ CGNTF++KP
Sbjct: 123 IGTLQMGEFSENVAGGVDTYTLRQPIGVCAGITPFNFPAMIPLWMFPMAIACGNTFVLKP 182

Query: 211 SERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIF 270
           SE+ P +TMLL +L  ++G P G LN++HG  + V+ +C H DIKA+SFVGS   G +++
Sbjct: 183 SEQDPLSTMLLVELALEAGVPAGVLNVVHGGKDVVDALCTHKDIKAVSFVGSTAVGTHVY 242

Query: 271 ERGSRHGKRVQANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAK 330
           +   +HGKRVQ+ MGAKNH VV+PDAN+E+TLN LVGA FGAAGQRCMA S  VLVG +K
Sbjct: 243 DLAGKHGKRVQSMMGAKNHAVVLPDANREHTLNALVGAGFGAAGQRCMATSVVVLVGASK 302

Query: 331 KWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKV 390
           +WLP+L   A+ L+VNAG + G D+GP+I+ +AK R+  LI+SG KEGA + LDGR IKV
Sbjct: 303 QWLPDLKALAQKLKVNAGSEAGTDVGPVISKRAKARILELIESGVKEGAKLELDGRDIKV 362

Query: 391 KGYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIF 450
            G+E GNFVGPT+ S V P+M  Y +EIFGPVLVVLE  TLDEAI +VN NP+GNGT +F
Sbjct: 363 PGFEQGNFVGPTLFSGVTPSMQIYTQEIFGPVLVVLEVATLDEAIALVNANPFGNGTGLF 422

Query: 451 TTNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLK 510
           T +GA ARK+   +DVGQVG+N+PIPVP+P FSFTGSR S  GD   YGKQ +QFYTQ K
Sbjct: 423 TQSGAAARKFQSEIDVGQVGINIPIPVPVPFFSFTGSRGSKLGDLGPYGKQVVQFYTQTK 482

Query: 511 TITSQWKEED 520
           T+TS+W ++D
Sbjct: 483 TVTSRWFDDD 492


Lambda     K      H
   0.318    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 674
Number of extensions: 31
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 535
Length of database: 505
Length adjustment: 35
Effective length of query: 500
Effective length of database: 470
Effective search space:   235000
Effective search space used:   235000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory