Align BadI (characterized)
to candidate GFF2712 PS417_13835 crotonase
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__WCS417:GFF2712 Length = 367 Score = 73.9 bits (180), Expect = 4e-18 Identities = 49/155 (31%), Positives = 76/155 (49%), Gaps = 4/155 (2%) Query: 4 EDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFC 63 ++++ E+RN + + +NRP +NA L L D V A+VL GAG++AFC Sbjct: 17 DEVLAEVRNHIGHLTLNRPAGLNAITLNMVRRLASQLKAWADDPQVYAVVLRGAGEKAFC 76 Query: 64 TGGD-QSTHDGNYDG---RGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICD 119 GGD +S +D +G + L AI KPV+A + G+ +GGG L D Sbjct: 77 AGGDIRSLYDSFKNGDTLHQDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGAD 136 Query: 120 LTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGE 154 L + +E++ +G G+ FL R+ GE Sbjct: 137 LRVVTERSRLAMPEVAIGYFPDVGGSYFLPRIPGE 171 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 367 Length adjustment: 27 Effective length of query: 233 Effective length of database: 340 Effective search space: 79220 Effective search space used: 79220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory