GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaK in Pseudomonas simiae WCS417

Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate GFF4308 PS417_22065 long-chain fatty acid--CoA ligase

Query= BRENDA::D3GE78
         (556 letters)



>lcl|FitnessBrowser__WCS417:GFF4308 PS417_22065 long-chain fatty
           acid--CoA ligase
          Length = 563

 Score =  196 bits (499), Expect = 2e-54
 Identities = 155/524 (29%), Positives = 249/524 (47%), Gaps = 33/524 (6%)

Query: 46  LTTHDLRLWSQRLAAGLRK-SGLQRGDRVLLFSGNDLFFPVVFLGVIMAGGIFTGANPTF 104
           +T  +L   S   AA L++ + L+ GDR+ +   N L +PV   G I AG I    NP +
Sbjct: 50  ITYGELYELSGAFAAYLQQHTDLKPGDRIAVQLPNVLQYPVAVFGAIRAGLIVVNTNPLY 109

Query: 105 VARELAYQLQDSGATYLLCASNSLETGLEAAKQAKLPQSHIFAYDTSIYDGVTNPQKGCA 164
            ARE+ +Q  DSGA  L+C +N      +   +  +   H+    T + D +  P K   
Sbjct: 110 TAREMEHQFNDSGAKALVCLANMAHLAEKVVPKTAV--KHVIV--TEVAD-LLPPLKRLL 164

Query: 165 ------YWSDLLASEEEGAAFTWDEL----------STPALSSTTLALNYSSGTTGRPKG 208
                 Y   ++ +     A  ++++               SS    L Y+ GTTG  KG
Sbjct: 165 INSVIKYVKKMVPAYHLPNAIKFNDVLAKGHGQPVSDASPTSSDVAVLQYTGGTTGVAKG 224

Query: 209 VEISHRNYVANMLQYCHTASLHPDYKARLERSRWLCFLPMYHAMAQNIF-IAAALYRATP 267
             ++HRN VANMLQ       + +    +     +  LP+YH  A     +A  L     
Sbjct: 225 AMLTHRNLVANMLQCKALMGSNLNEGCEI----LITPLPLYHIYAFTFHCMAMMLIGNHN 280

Query: 268 VYIMSKFDFVKMLEYTQRFRITDFILVPPVVVALAKHPAVGQYDLSSVELVGSGAAPLGR 327
           + I +  D   M++   +++ + F+ +  + VAL  + A  + D S++++  SG   L  
Sbjct: 281 ILISNPRDLPAMVKELSKWKFSGFVGLNTLFVALCNNEAFRKLDFSALKVTLSGGMALQL 340

Query: 328 EVCEEVEKLWPPGKINIKQGWGMTEATCSVTGWNPAEISTSASVGELNANCEAKIMFDGV 387
              E  + +   G   I +G+GMTE T  V   NP +     ++G    +   K++ D  
Sbjct: 341 AAAERWKAVTGCG---ICEGYGMTE-TSPVATVNPIQHIQIGTIGIPVPSTVCKVIADDG 396

Query: 388 EVKERNSRGELWVRAPNVMKGYWRNEKATKETKTEDGWLLTGDIAFVDDDGKFHVVDRMK 447
                   GEL V+ P VMKGYW+ + AT E    +GWL TGDIA +  DG   +VDR K
Sbjct: 397 TELALGETGELCVKGPQVMKGYWQRQDATDEMLDSEGWLKTGDIAIIQPDGYMRIVDRKK 456

Query: 448 ELIKVKGNQVAPAELEALLLEHPAISDVAVIGVV-INNDERPRAYVVLRPGQSATANEIA 506
           ++I V G  V P ELE +L   P +   A IGV    + E  + ++V++PG + T  ++ 
Sbjct: 457 DMILVSGFNVYPNELEDVLAGLPGVLQCAAIGVPDEKSGEHIKLFIVVKPGATLTKEQVM 516

Query: 507 HYLDNKVSAFKRITGGVVFLEAIPKNPSGKILRMKLREQAKEEL 550
            ++   V+A+K +   V F +A+P    GKILR +LR++  ++L
Sbjct: 517 EHMRANVTAYK-VPKAVEFRDALPTTNVGKILRRELRDEELKKL 559


Lambda     K      H
   0.319    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 645
Number of extensions: 27
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 556
Length of database: 563
Length adjustment: 36
Effective length of query: 520
Effective length of database: 527
Effective search space:   274040
Effective search space used:   274040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory