Align flavohemoprotein; EC 1.14.12.17 (characterized)
to candidate GFF4572 PS417_23400 dihydropteridine reductase
Query= CharProtDB::CH_003330 (396 letters) >FitnessBrowser__WCS417:GFF4572 Length = 393 Score = 268 bits (685), Expect = 2e-76 Identities = 163/401 (40%), Positives = 215/401 (53%), Gaps = 14/401 (3%) Query: 1 MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQREALFNA 60 ML AQ A VK+T+PLL G L HFY M + P+++ +FN ++Q +GDQ AL N Sbjct: 1 MLSAQDRAIVKSTVPLLESGGEALITHFYRMMLSEYPQVRPLFNQAHQASGDQPRALANG 60 Query: 61 IAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFS---PGQEVL 117 + YA +I+ L L V KI KH + QI PE Y IVG LL + E+ EV+ Sbjct: 61 VLMYARHIDQLDQLGDLVAKIINKHVALQILPEHYPIVGACLLRAISEVLGSEIATPEVM 120 Query: 118 DAWGKAYGVLANVFINREAEIYNENASKAGGWEGTRDFRIVAKTPRSALITSFELEPVDG 177 AWG AYG LA++ I EA IY E A GGW G R F +V + S I SF P D Sbjct: 121 SAWGAAYGQLADILIGAEAAIYEEKAQAPGGWRGARPFLLVKRVEESDEIISFYFAPADN 180 Query: 178 GAVAEYRPGQYLGVWLKPEGFPHQEIRQ-YSLTRKPDGKGYRIAVKREEGGQVSNWLHNH 236 G + PGQY+G+ L +G +E+R+ YSL+ D YRI+VKRE GG+VSN+LH+ Sbjct: 181 GPILAAAPGQYIGMKLLLDG---EEVRRNYSLSALTDAGVYRISVKREAGGRVSNYLHDQ 237 Query: 237 ANVGDVVKLVAPAGDFFMAVADDTPVTLISAGVGQTPMLAMLDTLAKAGHTAQVNWFHAA 296 VG + L P+G+F +A A D P+ LIS GVG TP L ML+ A V++ H A Sbjct: 238 MQVGATIDLFPPSGEFTLA-ASDKPLVLISGGVGITPTLPMLE--AALATERPVHFIHCA 294 Query: 297 ENGDVHAFADEVKELGQSLPRFTAHTWYRQPSEADRAKGQFDSEGLMDLSKLEGAFSDP- 355 NG VHAF D V L P+ + Y + + A D GL+ +L + Sbjct: 295 RNGGVHAFRDWVDALAAKHPQLKRYYCYAEDNGVSPAA---DKVGLLSQDQLAAWLPEQR 351 Query: 356 TMQFYLCGPVGFMQFTAKQLVDLGVKQENIHYECFGPHKVL 396 + Y GP GFM + L LGV ++ YE FGP L Sbjct: 352 DIDAYFLGPKGFMAAIKRHLQALGVPEKQSRYEFFGPAAAL 392 Lambda K H 0.318 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 393 Length adjustment: 31 Effective length of query: 365 Effective length of database: 362 Effective search space: 132130 Effective search space used: 132130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory