GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aroP in Pseudomonas simiae WCS417

Align Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized)
to candidate GFF4632 PS417_23700 aromatic amino acid transporter

Query= TCDB::P15993
         (457 letters)



>lcl|FitnessBrowser__WCS417:GFF4632 PS417_23700 aromatic amino acid
           transporter
          Length = 467

 Score =  617 bits (1592), Expect = 0.0
 Identities = 301/453 (66%), Positives = 363/453 (80%), Gaps = 9/453 (1%)

Query: 11  LKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEMV 70
           LKRGLKNRHIQLIALGGAIGTGLFLGSA V++SAGP +ILGYAIAGFIAFLIMRQLGEM+
Sbjct: 11  LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMI 70

Query: 71  VEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWVS 130
           VEEPVAGSFSHFA+KYWG +AGF +GWNYWVLYVLV MAELTAVGKYIQFW+P+IPTWVS
Sbjct: 71  VEEPVAGSFSHFAHKYWGGYAGFLAGWNYWVLYVLVGMAELTAVGKYIQFWWPDIPTWVS 130

Query: 131 AAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGNGGPQATVSNLW 190
           A VFFV +N IN  NVK FGE EFWFAIIKV+A+V MI+ G +LLFSG GGPQA+VSNLW
Sbjct: 131 ALVFFVAVNLINTLNVKFFGETEFWFAIIKVVAIVGMIVLGCYLLFSGTGGPQASVSNLW 190

Query: 191 DQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYI 250
             GGF P+G  GL+M MA IMFSFGGLELVGITAAEA  P + IPKA NQV+YRILIFY+
Sbjct: 191 SHGGFFPNGGMGLLMSMAFIMFSFGGLELVGITAAEASEPRKVIPKAINQVVYRILIFYV 250

Query: 251 GSLAVLLSLMPWTRV---------TADTSPFVLIFHELGDTFVANALNIVVLTAALSVYN 301
           G+L VLLSL PW ++             SPFV IF  +G+   A+ LN VVLTAALSVYN
Sbjct: 251 GALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFSLIGNDTAAHILNFVVLTAALSVYN 310

Query: 302 SCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFGL 361
           S VYCNSRMLFGLA+QG+APK+L  ++K+GVP+  + +SALVT LCV++NY+AP+SA  L
Sbjct: 311 SGVYCNSRMLFGLAEQGDAPKSLMKLNKQGVPIRALAISALVTMLCVVVNYVAPQSALEL 370

Query: 362 LMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIML 421
           L ALVV++L+INWA+IS+ H+KFR+A  EQGV   F    +P  N++CL FM  ++ +ML
Sbjct: 371 LFALVVASLMINWALISITHIKFRKAMGEQGVTPSFKTFWFPFSNYLCLAFMVMIISVML 430

Query: 422 MTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAV 454
             PG++ SVY +PVW+ ++ + Y  + + + AV
Sbjct: 431 AIPGISESVYAMPVWVGIIYVAYRLRVRRSHAV 463


Lambda     K      H
   0.328    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 741
Number of extensions: 26
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 457
Length of database: 467
Length adjustment: 33
Effective length of query: 424
Effective length of database: 434
Effective search space:   184016
Effective search space used:   184016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory