Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate GFF990 PS417_05020 fumarylacetoacetase
Query= BRENDA::Q94272 (418 letters) >FitnessBrowser__WCS417:GFF990 Length = 428 Score = 364 bits (934), Expect = e-105 Identities = 204/419 (48%), Positives = 266/419 (63%), Gaps = 20/419 (4%) Query: 10 NSDFPIQNLPYGVFSTKADSSRHIGVAIGDQILNLAEIANLFDGPQLKAHQDVFKQSTLN 69 ++DFP+QNLP GVFS + R GVAIGD IL+L + FDG +A + LN Sbjct: 17 HTDFPLQNLPLGVFSINGSAPR-AGVAIGDSILDLQAAIDEFDGEARRAIEAT-AGGQLN 74 Query: 70 AFMALPRPAWLEARARIQQLLSEDCAVLRDNAHLRSRALVAQSDATMHLPAQIGDYTDFY 129 AF AL R + R R+ +LL+E + A + RA +D MH+PAQI DYTDFY Sbjct: 75 AFFALGRGPRVALRERLLELLAEGSTLHTREAQVLHRA----ADCQMHVPAQINDYTDFY 130 Query: 130 SSIHHATNVGIMFRGKENALMPNWKWLPVGYHGRASSIVVSGTDLKRPVGQTKAPDAEVP 189 I HA NVG +FR +N L+PN+K++P+GYHGRAS+I SGTD++RP GQT P Sbjct: 131 VGIEHAQNVGKLFR-PDNPLLPNYKYVPIGYHGRASTIRTSGTDVRRPKGQTLPAGQSEP 189 Query: 190 SFGPSKLMDFELEMAFFVGGPENELGTRVPIEKAEDRIFGVVLMNDWSARDIQAWEYVPL 249 +FGP +D+ELE+ ++G NE+G + I A D I G L+NDWSARDIQAWEY PL Sbjct: 190 TFGPCARLDYELELGIWIG-QGNEMGDSIAIGDAADHIAGFCLLNDWSARDIQAWEYQPL 248 Query: 250 GPFLAKSFATTVSPWVVSIEALRPYFVENPVQ---DPVPPAYL---HHDDPFTLDINLAV 303 GPFL+KSF TT+SPWVV+ EAL P+ P + DP P +YL LDI L V Sbjct: 249 GPFLSKSFITTISPWVVTAEALEPFRKAQPARPEGDPQPLSYLLDKRDQAAGALDIELEV 308 Query: 304 SIRP----EGDAVDHIVCKTNFKHLYWTLKQQLAHHTVNGCNLRAGDLLGSGTVSGPEEG 359 + E + H + +N H+YWT+ Q +AHH+VNGC L+AGDL GSGT+SGP+ G Sbjct: 309 LLTTAAMREQNLPAHRLALSNSLHMYWTVAQLVAHHSVNGCQLQAGDLFGSGTLSGPQAG 368 Query: 360 AYGSMLELSWRGAKEVPVGS-EIRKFLKDGDEVNLSGVCEKNG-VRIGFGECRGKVLPA 416 +GS+LE++ G K V + S E+RKFL+DGDE+ L C + G IGFGECRG V+ A Sbjct: 369 QFGSLLEMTEGGKKPVELPSGEVRKFLEDGDEIILRARCNREGFASIGFGECRGTVIAA 427 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 30 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 428 Length adjustment: 32 Effective length of query: 386 Effective length of database: 396 Effective search space: 152856 Effective search space used: 152856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF990 PS417_05020 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.2063033.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-190 618.5 0.0 3.3e-190 618.3 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF990 PS417_05020 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF990 PS417_05020 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.3 0.0 3.3e-190 3.3e-190 1 419 [. 9 427 .. 9 428 .] 0.97 Alignments for each domain: == domain 1 score: 618.3 bits; conditional E-value: 3.3e-190 TIGR01266 1 sfvavak.nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkestlnaflalg 75 s+va+a+ ++dfplqnlP+Gvfs ++s +r gvaiGd+ildl+++ + f+g ++++ e++ ++ lnaf+alg lcl|FitnessBrowser__WCS417:GFF990 9 SWVASANgHTDFPLQNLPLGVFS-INGSAPRAGVAIGDSILDLQAAID--EFDG-EARRAIEATAGGQLNAFFALG 80 8******9***************.7899****************9999..9***.8899***************** PP TIGR01266 76 rparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhatnvGilfrgkdnallP 151 r r+++rerl++ll+e + + ++l+ +a+++mh+Paqi dytdfy++i+ha+nvG+lfr +dn+llP lcl|FitnessBrowser__WCS417:GFF990 81 RGPRVALRERLLELLAEGSTL----HTREAQVLHRAADCQMHVPAQINDYTDFYVGIEHAQNVGKLFR-PDNPLLP 151 ****************77766....4556789************************************.******* PP TIGR01266 152 nykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaffvgtenelGeavpiekaeehif 227 nyk++P+gyhGras++++sGt++rrP+Gq+++++ +eP+fgpc++ld+elel++++g++ne+G+++ i a++hi+ lcl|FitnessBrowser__WCS417:GFF990 152 NYKYVPIGYHGRASTIRTSGTDVRRPKGQTLPAGQSEPTFGPCARLDYELELGIWIGQGNEMGDSIAIGDAADHIA 227 **************************************************************************** PP TIGR01266 228 GvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfrvaq.lePeqdpkplpylredr..adtafd 300 G++llndwsardiqawey+PlGPfl+ksf+tt+sPwvv++ealePfr+aq ++Pe+dp+pl+yl ++r a a+d lcl|FitnessBrowser__WCS417:GFF990 228 GFCLLNDWSARDIQAWEYQPLGPFLSKSFITTISPWVVTAEALEPFRKAQpARPEGDPQPLSYLLDKRdqAAGALD 303 **************************************************9**************999556689** PP TIGR01266 301 ielevslkteGlae....aavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllelsak 372 ielev l+t+ ++e a++++ sn++++ywt++q +ahhsvnGc+l+aGdl+gsGt+sG++ ++fGslle++ + lcl|FitnessBrowser__WCS417:GFF990 304 IELEVLLTTAAMREqnlpAHRLALSNSLHMYWTVAQLVAHHSVNGCQLQAGDLFGSGTLSGPQAGQFGSLLEMTEG 379 *************9889889******************************************************** PP TIGR01266 373 GkkevkladgetrkfledGdevilrgvckkeGvr.vGfGecaGkvlpa 419 Gkk+v+l +ge+rkfledGde+ilr++c++eG +GfGec+G+v++a lcl|FitnessBrowser__WCS417:GFF990 380 GKKPVELPSGEVRKFLEDGDEIILRARCNREGFAsIGFGECRGTVIAA 427 ********************************988**********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (428 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.66 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory