Align branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized)
to candidate GFF3451 PS417_17665 ABC transporter permease
Query= ecocyc::LIVH-MONOMER (308 letters) >FitnessBrowser__WCS417:GFF3451 Length = 286 Score = 149 bits (377), Expect = 6e-41 Identities = 91/297 (30%), Positives = 164/297 (55%), Gaps = 18/297 (6%) Query: 8 FLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAALMMMGID 67 +L Q+ NG+ LG Y LI++G T+++G++ +NFAHG +++G+Y+ + A+ + G Sbjct: 5 YLFQILNGLGLGMIYFLISVGLTIIFGLLNFVNFAHGAFFLLGAYICY---TAVSLTG-- 59 Query: 68 TGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEG 127 WL + A ++ +A W IERV + + + + ++ +G+++ +Q + G Sbjct: 60 NFWLALLI----APLVVAALAWVIERVLIQRIYHLPHMFQILVTLGIALIIQEASVMIWG 115 Query: 128 --SRDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACR 185 + VA+P L G VVG +F + +++ + L L L + + +R G R Sbjct: 116 PVGKSVAVPELLRGVLVVG---DFVYPYYRLFLIVF--SGLVGLGLWLLLERTRFGALVR 170 Query: 186 ACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGMKAFTA 245 A +E + SLLG N R+ ++TF +G A+A VAGVL G P++G AF Sbjct: 171 AGSESTETVSLLGTNIFRLFSMTFALGVALAGVAGVLFAPLRGA-QPFVGPEILGVAFVV 229 Query: 246 AVLGGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGILGR 302 V+GG+GS GA++GGL++G+ ++L + L + ++ + + +V+LV P G+ GR Sbjct: 230 VVIGGMGSFSGALVGGLLVGVVQSLMTT-LWPQGASLMIYGAMAVVILVRPYGLFGR 285 Lambda K H 0.328 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 286 Length adjustment: 26 Effective length of query: 282 Effective length of database: 260 Effective search space: 73320 Effective search space used: 73320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory