Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate GFF523 PS417_02665 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >FitnessBrowser__WCS417:GFF523 Length = 425 Score = 407 bits (1045), Expect = e-118 Identities = 219/414 (52%), Positives = 289/414 (69%), Gaps = 13/414 (3%) Query: 9 LFSALLVWAVAYPVLGLKLTIVGINLEVHGTSPAILATIAVC---SLLMFLRVLFSTQIS 65 + + L+ V P++G+ L NLE A+L I + ++ +FL+ +I Sbjct: 17 VLAGLISLVVFGPIVGVVLDGYSFNLEP--ARVALLVAIVMVGRFAMSLFLQTPKGVKIL 74 Query: 66 AMWKSS-PGLPVIPAKASNFLTLPTTQRWIVLALIVGALVWPFFGSRGAVDIATLILIYV 124 ++S+ G+ V+ + L RWI+ ALIV A+V+P F ++ + + L LIYV Sbjct: 75 QGFESTGSGVHVLAPDYKSRL------RWIIPALIVIAIVFPIFANKYLLTVVILGLIYV 128 Query: 125 MLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGMMAATFGFLL 184 +LGLGLNIVVGLAGLLDLGYV FYA+GAY AL Y GL FW LP+A + AA G +L Sbjct: 129 LLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGFWTVLPLAAIAAALAGCIL 188 Query: 185 GFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGLTFERKAAEG 244 GFPVLR+ GDYLAIVTLGFGEIIRL L N TGGPNG+ + PTF GL F ++A +G Sbjct: 189 GFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSFTGGPNGMP-VPSPTFLGLEFGKRAKDG 247 Query: 245 LQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEIACRA 304 FHE+FG++YN K +F+Y+V L+ LA L++ +RL RMP+GRAWEALREDEIACR+ Sbjct: 248 GIPFHEFFGIDYNPNIKFLFIYIVLFLVVLAVLYIKHRLTRMPVGRAWEALREDEIACRS 307 Query: 305 LGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGMGSQL 364 +GLN ++KLSAFT+GA+ AG AG FFA+ QG V P SFTF ESA+ILAIVVLGGMGS + Sbjct: 308 MGLNHVLVKLSAFTIGASTAGLAGVFFASYQGFVNPSSFTFFESALILAIVVLGGMGSTV 367 Query: 365 GVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLLPMQRPHMELRK 418 GV++AA V+ + PE++R FSEYR+L+FG LMV+MMIWRP+GL+ + R + RK Sbjct: 368 GVVIAAFVLTVAPELLRSFSEYRVLLFGVLMVVMMIWRPRGLIRISRTGVTPRK 421 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 641 Number of extensions: 37 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 425 Length adjustment: 32 Effective length of query: 386 Effective length of database: 393 Effective search space: 151698 Effective search space used: 151698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory