Align ABC transporter permease (characterized, see rationale)
to candidate GFF522 PS417_02660 branched-chain amino acid transporter permease subunit LivH
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__WCS417:GFF522 Length = 304 Score = 264 bits (674), Expect = 2e-75 Identities = 145/304 (47%), Positives = 204/304 (67%), Gaps = 14/304 (4%) Query: 3 ILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMP 62 I LQQ++NGL LGS+Y LIA+GYTMVYGII +INFAHGEV MI A + + ++ A Sbjct: 4 IFLQQLVNGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYMISAYLAAISLALL--AYF 61 Query: 63 GAPGWVILLLATII-ACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMI 121 G + +L+L T+I VV +VIE+VAY+PLR+S RLAPLI+AIG+S++LQ A I Sbjct: 62 GIESFPLLILGTLIFTVVVTGVYGWVIERVAYKPLRNSTRLAPLISAIGISLILQNYAQI 121 Query: 122 IWKPNYKPYPTMLPSS-PFEIGGAFI--TPTQILILGVTAVALASLVYLVNHTNLGRAMR 178 + PT+L + +IG F+ T T++ IL +A L Y++ +T LGR R Sbjct: 122 AQGAKQQGIPTLLAGAWRVDIGSGFVQLTYTKVFILVAAFAGMALLTYVIKYTKLGRMCR 181 Query: 179 ATAENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTA 238 AT ++ ++AS++G+ D VIS F+IGA +AA+AG++ NYGT GF+ G+KAFTA Sbjct: 182 ATQQDRKMASILGINTDRVISYVFVIGAAMAALAGVLITLNYGTFDFYAGFIIGIKAFTA 241 Query: 239 AVFGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPS 298 AV GGIG+L GA++GGI+LG+ E++ S GL+ S Y D+F+F +L++IL RP Sbjct: 242 AVLGGIGSLPGAMLGGIILGISESLFS--------GLINSDYKDVFSFSLLVVILIFRPQ 293 Query: 299 GLLG 302 GLLG Sbjct: 294 GLLG 297 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 304 Length adjustment: 27 Effective length of query: 282 Effective length of database: 277 Effective search space: 78114 Effective search space used: 78114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory