Align NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate GFF523 PS417_02665 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YY08 (377 letters) >FitnessBrowser__WCS417:GFF523 Length = 425 Score = 140 bits (354), Expect = 5e-38 Identities = 111/369 (30%), Positives = 174/369 (47%), Gaps = 77/369 (20%) Query: 3 EYLIFLAISTATFALFSLGLNLQWGFTGLINFGHIAFMTLGAYTTVL-LSLKGVPLFISA 61 +YL+ + I + L LGLN+ G GL++ G++AF +GAY L G+ + Sbjct: 115 KYLLTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGFWTVL 174 Query: 62 IVGAIFAALLGLVIGFATLRLREDYLAIVTIGTGELIRLVVNNQDLPVGDTWVSGAFGVQ 121 + AI AAL G ++GF LR+ DYLAIVT+G GE+IRLV+NN W+S G Sbjct: 175 PLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNN--------WLSFTGGPN 226 Query: 122 SYPIPLSTEPNLFFRLLMIGILTLLFAVTVFSLWRWIRNAQKLQLTDATDKTSSKQEIAS 181 P+P T L F A D E Sbjct: 227 GMPVPSPTFLGLEFG------------------------------KRAKDGGIPFHEF-- 254 Query: 182 RFGVGIILGLLATAIYISGVITLYNYIPKAGLMLVSLLVLAFVFWRLEYLVRSPWGRVLK 241 FG+ Y + L+ YI ++ L+VLA ++ + L R P GR + Sbjct: 255 -FGID----------YNPNIKFLFIYI------VLFLVVLAVLYIK-HRLTRMPVGRAWE 296 Query: 242 AIREDEEIPKAMGKNVFWYKLQSLMLGGAIAGIAGAFFAWQISAIYPDNFQPQLTFDSWI 301 A+REDE ++MG N KL + +G + AG+AG FFA + P +F F+S + Sbjct: 297 ALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFASYQGFVNPSSF---TFFESAL 353 Query: 302 ---MVILGGAGNNIGSILGAVIYFAYDAITREVLPKIIPLDEARLGAFRIMCIGLILMVL 358 +V+LGG G+ +G ++ A + V P+++ +R++ G++++V+ Sbjct: 354 ILAIVVLGGMGSTVGVVIAAFVL--------TVAPELL----RSFSEYRVLLFGVLMVVM 401 Query: 359 MIWRPQGIL 367 MIWRP+G++ Sbjct: 402 MIWRPRGLI 410 Lambda K H 0.328 0.145 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 377 Length of database: 425 Length adjustment: 31 Effective length of query: 346 Effective length of database: 394 Effective search space: 136324 Effective search space used: 136324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory