Align Glycine betaine/proline/ectoine/pipecolic acid transporter OusA; Osmoprotectant uptake system A (characterized)
to candidate GFF2854 PS417_14575 MFS transporter
Query= SwissProt::Q47421 (501 letters) >FitnessBrowser__WCS417:GFF2854 Length = 445 Score = 306 bits (783), Expect = 1e-87 Identities = 169/438 (38%), Positives = 250/438 (57%), Gaps = 12/438 (2%) Query: 24 LRKAITAAALGNAMEWFDFGVYGFVAYALGQVFFPGADPGVQMIAALATFSVPFLIRPLG 83 LRK I AA +GN +EWFDF VYGF+A + Q FFP D ++ A F+V F RPLG Sbjct: 14 LRKVIIAAGIGNFVEWFDFAVYGFLATTIAQQFFPSGDASAALLKTFAVFAVAFAFRPLG 73 Query: 84 GVFFGALGDKYGRQKILAITIIIMSISTFCIGLIPSYERIGIWAPILLLLAKMAQGFSVG 143 G+FFG LGD+ GR++ LA+TI++M+ +T IGL+P+Y IG+ APILL L + AQGFS G Sbjct: 74 GIFFGMLGDRIGRKRTLAMTILLMAGATTLIGLLPTYAAIGVAAPILLSLIRCAQGFSAG 133 Query: 144 GEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTLIGEQAFLAWGWRL 203 GEY GA ++ E++P KR + GS++ + + F A V + + +A +WGWRL Sbjct: 134 GEYAGACAYLMEHAPSDKRAWYGSFVPVSTFSAFAAAAVVAYALEASLSAEAMGSWGWRL 193 Query: 204 PFFLALPLGLIGLYLRHALEETPAFRQHVEKLEQNDRDGLKAGPGVSFREIATHHWKSLL 263 PF +A PLGL+GLYLR L+ETPAF Q V++ LK E +H ++ Sbjct: 194 PFLIAAPLGLVGLYLRWKLDETPAF-QAVKEEHTVAHSPLK--------ETLRNHGAAIS 244 Query: 264 VCIGLVIATNVTYYMLLTYMPSYLSHSLHYSENHGVLIIIAIMIGMLFVQPVMGLLSDRF 323 V T +++YM TY +YL + S +L+ + +I + P+ GL SDR Sbjct: 245 CLGAFVSLTALSFYMFTTYFATYLQVAGGLSRAMALLVSLIALIFAAAICPLAGLYSDRV 304 Query: 324 GRKPFVVIGSVAMFFLAVPSFMLINSDIIGLIFLGLLMLAVILNAFTGVMASTLPALFPT 383 GR+ V+ V + + PSF++ +S +G+++LAV V A+ L FPT Sbjct: 305 GRRATVMTACVLLMVVVYPSFLMASSGSFAASIVGVMLLAVGAVLCGVVTAALLSETFPT 364 Query: 384 HIRYSALASAFNIS-VLIAGLTPTVAAWLVESSQNLYMPAYYLMVIAVIGLLTGLFMKET 442 RY+A A +N++ + G P +A WL+ ++ + PA+YL+ +A++ L GL + ET Sbjct: 365 RTRYTASAITYNLAYTIFGGTAPLMATWLISTTGSNLSPAFYLIAVALLALAGGLALPET 424 Query: 443 ANKPLKGATPAASDLSEA 460 + L A D S A Sbjct: 425 SRISLHDV--GAEDKSSA 440 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 501 Length of database: 445 Length adjustment: 33 Effective length of query: 468 Effective length of database: 412 Effective search space: 192816 Effective search space used: 192816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory