Align Aconitate isomerase; AI; EC 5.3.3.7 (uncharacterized)
to candidate GFF1422 PS417_07225 molybdenum ABC transporter substrate-binding protein
Query= curated2:A0A0A1H8I4 (262 letters) >FitnessBrowser__WCS417:GFF1422 Length = 252 Score = 197 bits (502), Expect = 1e-55 Identities = 115/258 (44%), Positives = 157/258 (60%), Gaps = 11/258 (4%) Query: 1 MFPRLPTLALGALLLASTPLLAAQPVTTLTVLSSGGIMGTIREVAPAYEKATGVKLDIAA 60 ++ L LALG L L+ + A Q L V++SGG + + P Y K +G L+ Sbjct: 4 LYKTLSALALGVLSLS---VQAEQ----LKVMTSGGFTAAYKVLGPQYAKQSGDSLETIL 56 Query: 61 APSMGDTPQAIPNRLARNEPADVVLMVGSALDKLVASGQVAKDSRVDLGQSFIAMAVRQG 120 PSMG P+AIPNRLAR E ADVV+MVG ALD+L+ G+V SRV+L S I + V+ G Sbjct: 57 GPSMGKAPEAIPNRLARGEHADVVIMVGYALDELIKQGKVDPASRVELADSRIGLVVKAG 116 Query: 121 APKPDISNMDAFKQTLEKAQSVAYSDSASGVYLSRILFPRMQLDKSFMAKARMIPAEPVG 180 A KP I K L KA+SVAYSDSASGVY+ + LF ++ + AK MI PV Sbjct: 117 AVKPAIGTDAELKAVLSKAKSVAYSDSASGVYVEKELFKKLGMP----AKGTMIERLPVA 172 Query: 181 AVVARGEAQLGFQQLSELKAVPGIDIVGLIPDQAQKMTLYSGAMVSKSQHPEAARALLQY 240 VA+G+ ++G QQ++EL VPG+ VG IP+ Q +T ++ + ++HPE A+ALLQY Sbjct: 173 EQVAKGDYEVGLQQVAELLPVPGVTYVGKIPEDVQSVTRFAAGIPLNAEHPEQAKALLQY 232 Query: 241 LASKDAAKAIEDSGLKPV 258 LAS A ++ +GL V Sbjct: 233 LASPQAQPVVQATGLDSV 250 Lambda K H 0.316 0.130 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 252 Length adjustment: 24 Effective length of query: 238 Effective length of database: 228 Effective search space: 54264 Effective search space used: 54264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory