Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate GFF5028 PS417_25760 spermidine/putrescine ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__WCS417:GFF5028 Length = 370 Score = 267 bits (683), Expect = 3e-76 Identities = 152/323 (47%), Positives = 208/323 (64%), Gaps = 13/323 (4%) Query: 19 LLEIRNLTKSYDGQHA-VDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIM 77 L+ R + KSYDG++ V D++L I KGE LLG SG GK+T L MLAGFE P+AG+I Sbjct: 10 LVSFRGVQKSYDGENLIVKDLNLEIRKGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEIQ 69 Query: 78 LDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLV 137 L G ++ VPP+ R I M+FQ+YALFPHMTV +N+AF L L K +I+ RV +L +V Sbjct: 70 LAGRSINNVPPHKRDIGMVFQNYALFPHMTVAENLAFPLSVRALSKTDISERVKRVLSMV 129 Query: 138 HMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILE 197 + FA+R P QLSGGQ+QRVALAR+L P+L+L+DEP+GALDK+LR+ MQ+E+ + + Sbjct: 130 QLDAFAQRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREHMQMEIKHLHQ 189 Query: 198 RVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFE 257 R+GVT V VTHDQ EA+TM+ R+A+ ++G+ QI P +YE P + A FIG N Sbjct: 190 RLGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQIAAPRTLYEEPKNTFVANFIGENNRLN 249 Query: 258 GVLKERQEDGLVLDSPGLVHPLKVDADASVVDNV--PVHVALRPEKIMLCEEPPANGC-N 314 G L + V++ L KV+A A V V PV +++RPE++ L + C N Sbjct: 250 GRLHSHSGERCVVE---LARGEKVEALAVNVGQVGGPVTLSVRPERVSL--NGSSESCVN 304 Query: 315 FAVGEVIHIAYLGDLSVYHVRLK 337 G V YLGD HVR++ Sbjct: 305 RFSGRVAEFIYLGD----HVRVR 323 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 370 Length adjustment: 30 Effective length of query: 347 Effective length of database: 340 Effective search space: 117980 Effective search space used: 117980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory