Align putrescine transport system permease protein PotH (characterized)
to candidate GFF2768 PS417_14120 molybdenum ABC transporter permease
Query= CharProtDB::CH_088338 (317 letters) >FitnessBrowser__WCS417:GFF2768 Length = 226 Score = 83.6 bits (205), Expect = 4e-21 Identities = 60/221 (27%), Positives = 108/221 (48%), Gaps = 6/221 (2%) Query: 96 FDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWM 155 F A ++Q+A+++T L+IG P+A ++ ++ R + +V LP + + + Sbjct: 8 FSAIWLTVQLASLTTLILLVIGTPIALWLSRTRSWWRGPIGAVVALPLVLPPTVIGFYLL 67 Query: 156 GILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLV 215 + NG + F WLG+ T+ + + +G V +PF+V P+ A I + Sbjct: 68 LTMGPNGYVGQFTQWLGLG----TLTFSFAGLVVGSVIYSMPFVVQPLQNAFSAIGTRPL 123 Query: 216 EAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGG--PDSIMIGRV 273 E A L A P TFFTVI+PL + G I S+L F VGEF + ++GG PD + V Sbjct: 124 EVAATLRANPWNTFFTVILPLARPGFITASILGFAHTVGEFGVVLMIGGNIPDKTRVVSV 183 Query: 274 LWQEFFNNRDWPVASAVAIIMLLLLIVPIMWFHKHQQKSVG 314 + ++ A +A M++ + ++ + ++ +G Sbjct: 184 QIYDHVEAMEYAQAHWLAGSMVVFAFLVLLALYSSRKTKMG 224 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 226 Length adjustment: 25 Effective length of query: 292 Effective length of database: 201 Effective search space: 58692 Effective search space used: 58692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory