Align Putrescine transport system permease protein PotI (characterized)
to candidate GFF2268 PS417_11565 ABC transporter permease
Query= SwissProt::P0AFL1 (281 letters) >FitnessBrowser__WCS417:GFF2268 Length = 264 Score = 129 bits (323), Expect = 9e-35 Identities = 75/241 (31%), Positives = 133/241 (55%), Gaps = 13/241 (5%) Query: 16 LLLGF-----TFLYAPMLMLVIYSFNSSKLVTV-WAGWSTRWYGELLRDDAMMSAVGLSL 69 L LGF F+ AP++++ + +F +++ +G+S RW+ + + A SL Sbjct: 7 LALGFHGVVVLFMMAPLVVVCLVAFTPENTLSLPTSGFSLRWFRAVFERADFIQAFYNSL 66 Query: 70 TIAACAATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALA 129 +A AAT A ++ AA+ + R+ F G N F+ + +P+++P ++ G+++L LF + Sbjct: 67 ILAFTAATLATLIAVPAALAISRY-TFPGRNFFSALFLSPIIIPHLVLGVAMLRLFALMG 125 Query: 130 HAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVIT 189 + + LAHV T YV ++ + +DRS E+AA LGA+ +F IT Sbjct: 126 ------VNGSFTWLMLAHVVIITPYVLRLVLAAAIGIDRSAEQAAESLGASRFTLFRQIT 179 Query: 190 LPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLI 249 LPMI+P + GWLLAF S D++ ++ FVS P TLP+ ++ ++P + A++ L+ Sbjct: 180 LPMILPGVAGGWLLAFINSFDEVTLSIFVSSPATQTLPVRMYVYATESIDPMMAAVSALV 239 Query: 250 L 250 + Sbjct: 240 I 240 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 264 Length adjustment: 25 Effective length of query: 256 Effective length of database: 239 Effective search space: 61184 Effective search space used: 61184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory