Align RhaQ (characterized, see rationale)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 164 bits (415), Expect = 3e-45 Identities = 107/313 (34%), Positives = 171/313 (54%), Gaps = 10/313 (3%) Query: 16 RLGTPLRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMAL 75 RL L R+ S F V++ + LAS FL A NLS+ + A+IA M Sbjct: 18 RLRLNLARLVRSPAFYPFVGLVVVTLVMILASDTFLTASNLSNIARQVSINAIIAVGMTC 77 Query: 76 LVISGEIDLSVAAIIALASTAMGAAVQIGIGTPGLVL-IGIGTGLACGVFNGVLVSVLKL 134 ++++G IDLSV ++AL+ T + G+ PGL + G+ G+A G+ NG+ V+ L + Sbjct: 78 VILTGGIDLSVGPVMALSGTLTAGLMVAGL-PPGLAIGAGMLIGVAFGIGNGLFVAYLHM 136 Query: 135 PSIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLAVLFA 194 P I+VT+ TM + RG+ + P FA+FG+ + + ++ + V + Sbjct: 137 PPIIVTLATMGIARGLGLMYTDGYPISGLPDWFAFFGRESLFGIQVPILIMLLTYLVAYV 196 Query: 195 ILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRP 254 +L H T GR +YAIG N+ A R SG+ R K +++ ++G+ + IA + LTSRL S +P Sbjct: 197 LLQH-TRIGRYIYAIGGNEEAVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQP 255 Query: 255 SIAQGWELEVVTMVVLGGISILGGFRHDRGVFV---IAAFVMGLVTFGLGLLNLPGIVMS 311 + +EL+ + VVLGG SI GG RGV V + A ++G++ GL +L + V S Sbjct: 256 NAGVSFELDAIAAVVLGGASIAGG----RGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQS 311 Query: 312 IFIGLLIIVTIAI 324 + G +I++ I I Sbjct: 312 VIKGGIILLAIFI 324 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 330 Length adjustment: 28 Effective length of query: 309 Effective length of database: 302 Effective search space: 93318 Effective search space used: 93318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory