GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rhaQ in Pseudomonas simiae WCS417

Align RhaQ (characterized, see rationale)
to candidate GFF4163 PS417_21325 arabinose ABC transporter permease

Query= uniprot:Q7BSH2
         (337 letters)



>lcl|FitnessBrowser__WCS417:GFF4163 PS417_21325 arabinose ABC
           transporter permease
          Length = 321

 Score =  155 bits (391), Expect = 2e-42
 Identities = 92/309 (29%), Positives = 160/309 (51%), Gaps = 4/309 (1%)

Query: 22  RRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGE 81
           R+    W +LL A++  IFV ++L    FL   N+       +   + A  M   + SG 
Sbjct: 17  RKFLDDWVMLLAALS--IFVLSALFIDNFLSPLNMRGLGLAISTVGIAACTMLFCLASGH 74

Query: 82  IDLSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVTI 141
            DLSV ++IA A    G  ++        V   +  GL  G+ NG++++ L++ +++ T+
Sbjct: 75  FDLSVGSVIACAGVVAGIVIRDTDSVVLGVSAALAMGLVVGLINGIVIAKLRINALIATL 134

Query: 142 GTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLAVLFAILLHATN 201
            TM + RG++YI    +A G     F  FG G ++ V     ++ ++  V F  LL+ T 
Sbjct: 135 ATMQIVRGLAYIFSNGKAVGVMDEGFFVFGNGQLLGV-PVPIIITVLCFVFFGWLLNYTT 193

Query: 202 FGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRPSIAQGWE 261
           +GR   AIG N  AA  +G+ V+R K I+F + G++  +A V L SR+ S +P I QG+E
Sbjct: 194 YGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGLIGALAGVILASRMTSGQPMIGQGFE 253

Query: 262 LEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFIGLLIIVT 321
           L V++  VLGG+S+ GG    R V +    ++ ++   + L N+      +  G ++++ 
Sbjct: 254 LTVISACVLGGVSLSGGIGMIRHV-IAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLA 312

Query: 322 IAIPIIARR 330
           + I  + +R
Sbjct: 313 VIIDRMKQR 321


Lambda     K      H
   0.330    0.145    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 292
Number of extensions: 8
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 321
Length adjustment: 28
Effective length of query: 309
Effective length of database: 293
Effective search space:    90537
Effective search space used:    90537
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory