Align D-ribose-binding periplasmic protein; EC 3.6.3.17 (characterized)
to candidate GFF3464 PS417_17735 LacI family transcriptional regulator
Query= CharProtDB::CH_003593 (296 letters) >FitnessBrowser__WCS417:GFF3464 Length = 307 Score = 154 bits (390), Expect = 2e-42 Identities = 107/297 (36%), Positives = 167/297 (56%), Gaps = 12/297 (4%) Query: 4 KKLATLVSAVALSATVSANAMAKDTIALVVS--TLNNPFFVSLKDGAQKEADKLGYNLVV 61 K L L ++ L A A A I + S +NNP+FV++K+ ++ +G L++ Sbjct: 6 KTLCLLAVSITLGTAAPAFADAAKPIRIGASFQEINNPYFVTMKNALEEAGATIGAKLII 65 Query: 62 LDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMANQANIPVITLDRQATKGE 121 D++++ +K++++V+D+ +G ILLINPTDS V +AVK A+ A + V+ +D QA G Sbjct: 66 TDARHDVSKQVSDVEDMLQKGIDILLINPTDSVGVQSAVKSAHAAGVVVVAVDAQA-DGP 124 Query: 122 VVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTSAARERGEGFQQAVAAH-KFN 180 + S + S N G A +Y+AK G+ + L GIA ER G ++AVA H Sbjct: 125 LDSFVGSKNFDAGFQACEYLAKNIGDKGNIAILDGIA-VVPILERVRGCKEAVAKHPDIK 183 Query: 181 VLASQPADFDRIKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKSDVMVVGFD 240 +++ Q +R + L V +N+L A P ++ +F+ ND +LGAL A++ +G DV +V D Sbjct: 184 IVSIQNGKQERDQALTVTENMLQAQPTLKGIFSVNDNGSLGALSAIEASG-LDVKLVSVD 242 Query: 241 GTPDGEKAVN--DGKLAATIAQLP-DQIG-AKGVETADKVLKGEKVQAKYPVDLKLV 293 G P+ KA+ K AT AQ P DQI A G+ A K G +V A PVD+ L+ Sbjct: 243 GAPEAIKAIQKPGSKFIATSAQYPRDQIRLALGIALARK--WGAQVPATLPVDITLI 297 Lambda K H 0.313 0.129 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 307 Length adjustment: 27 Effective length of query: 269 Effective length of database: 280 Effective search space: 75320 Effective search space used: 75320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory