Align Ribose import permease protein RbsC (characterized)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= SwissProt::P0AGI1 (321 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 273 bits (698), Expect = 4e-78 Identities = 139/297 (46%), Positives = 201/297 (67%), Gaps = 4/297 (1%) Query: 24 IALLVLIAIVSTLSPNFFTINNLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALT 83 + L+V+ ++ S F T +NL NI +Q S+NAI+AVGMT VILT GIDLSVG ++AL+ Sbjct: 36 VGLVVVTLVMILASDTFLTASNLSNIARQVSINAIIAVGMTCVILTGGIDLSVGPVMALS 95 Query: 84 GAVAASIVGIEVNALVAVAAALALGAAIGAVTGVIVAKGRVQAFIATLVMMLLLRGVTMV 143 G + A ++ + +A+ A + +G A G G+ VA + I TL M + RG+ ++ Sbjct: 96 GTLTAGLMVAGLPPGLAIGAGMLIGVAFGIGNGLFVAYLHMPPIIVTLATMGIARGLGLM 155 Query: 144 YTNGSPVNTGFTENADLFGWFGIGRPLGVPTPVWIMGIVFLAAWYMLHHTRLGRYIYALG 203 YT+G P++ D F +FG G+ P+ IM + +L A+ +L HTR+GRYIYA+G Sbjct: 156 YTDGYPISG----LPDWFAFFGRESLFGIQVPILIMLLTYLVAYVLLQHTRIGRYIYAIG 211 Query: 204 GNEAATRLSGINVNKIKIIVYSLCGLLASLAGIIEVARLSSAQPTAGTGYELDAIAAVVL 263 GNE A RLSG+ + K++VY + GL A++AG++ +RL S QP AG +ELDAIAAVVL Sbjct: 212 GNEEAVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQPNAGVSFELDAIAAVVL 271 Query: 264 GGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKK 320 GG S+AGG+G IVGTL+GA++LG LNNGLN+LGVS Y Q ++K +ILLA+ + ++ Sbjct: 272 GGASIAGGRGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQSVIKGGIILLAIFISRQR 328 Lambda K H 0.324 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 330 Length adjustment: 28 Effective length of query: 293 Effective length of database: 302 Effective search space: 88486 Effective search space used: 88486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory