GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ams in Pseudomonas simiae WCS417

Align Alpha-glucosidase; EC 3.2.1.20 (characterized, see rationale)
to candidate GFF4502 PS417_23045 trehalose-6-phosphate hydrolase

Query= uniprot:H3K096
         (538 letters)



>lcl|FitnessBrowser__WCS417:GFF4502 PS417_23045
           trehalose-6-phosphate hydrolase
          Length = 548

 Score =  283 bits (723), Expect = 2e-80
 Identities = 187/538 (34%), Positives = 270/538 (50%), Gaps = 63/538 (11%)

Query: 5   MMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFG 64
           M  W+  VIYQIYP+SF    G+  GDL GI +KLDY+  L VD +W++PF  SP  D G
Sbjct: 1   MQDWQHSVIYQIYPKSFHSHAGNATGDLLGIVDKLDYLKWLGVDCLWITPFLRSPQRDNG 60

Query: 65  YDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPK 124
           YD+SDY  +DP +GT+ D   L+ +A   G+K+M+D V++HTS +H WFQ++R +  NP 
Sbjct: 61  YDISDYYAIDPSYGTMADCDLLISEAAKRGIKLMLDIVVNHTSIEHEWFQQARSSLDNPY 120

Query: 125 ADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQ 184
            D+++W D       PNNW S FGGSAW ++++  QY+LH F  +Q D+N+ +P+ R   
Sbjct: 121 RDFYIWRD------QPNNWESKFGGSAWEYEAQTGQYFLHLFDHTQADLNWDNPKVRAEV 174

Query: 185 LDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDL 244
              MRFW D GV GFRLD +N     A+                 PE N  T  R  Y  
Sbjct: 175 FKLMRFWRDKGVGGFRLDVINLISKPADF----------------PEDN--TDGRRFY-T 215

Query: 245 SRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDK-LHMAYTFDLLNMP 303
             P   ++L+++   + E      VGE+   + LE    Y+    K L M + F  L + 
Sbjct: 216 DGPNVHEYLQEMHREVFEGHDLINVGEMSSTS-LEHCIRYSRPESKELSMTFNFHHLKVD 274

Query: 304 H-------SASY----LREVIERFQ--RLAGDAWPCWATSNHDVVRSATRWGADEDPHAY 350
           +        A +    L+++   +Q    AG  W      NHD  R  +R+G D +    
Sbjct: 275 YPNLQKWVKADFDFLQLKQIFTDWQLGMQAGGGWNALFWCNHDQPRVVSRFGNDGEHRVV 334

Query: 351 PKVMLA-VLFSLRGSVCLYQGEELGLPEADVPFERIQ------------------DPYGK 391
              MLA  L  L+G+  +YQGEELG+   +  F+RI+                  +P   
Sbjct: 335 SAKMLATALHFLQGTPYVYQGEELGM--TNPGFDRIEQYRDVESLNIFRLKRDAGEPEAS 392

Query: 392 VLWPEF-KGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVR 450
            +     K RD  RTPM W  GE  GFS  EPW+ + A   ++ V  Q DDP++ L+  R
Sbjct: 393 SMAAIMQKSRDNGRTPMQWNAGENAGFSTGEPWIGIPANAAQINVESQLDDPDSVLHHYR 452

Query: 451 ALLAFRRSHPALFDGDL-SLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEV 507
           AL+A RR  P + +G    L+     +  + R+   E LL + N  G   +  LP  V
Sbjct: 453 ALIALRRHEPLIQEGVYRPLLQDHLRVWAYLREGHGERLLVLNNFYGTPCEIQLPDNV 510


Lambda     K      H
   0.320    0.138    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 934
Number of extensions: 48
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 538
Length of database: 548
Length adjustment: 35
Effective length of query: 503
Effective length of database: 513
Effective search space:   258039
Effective search space used:   258039
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory