Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 221 bits (564), Expect = 2e-62 Identities = 131/315 (41%), Positives = 190/315 (60%), Gaps = 9/315 (2%) Query: 23 RLTTQERLRALGMLPV--LVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVI 80 RL +R+ P LV++ + + ++ F NLS IA+Q SIN ++A GMT VI Sbjct: 20 RLNLARLVRSPAFYPFVGLVVVTLVMILASDTFLTASNLSNIARQVSINAIIAVGMTCVI 79 Query: 81 LTGGIDLSVGSILSISAVVA---MLVSLMPQLGMLSVPAALLCGLLFGIVNGALVAFMKL 137 LTGGIDLSVG ++++S + M+ L P L ++ A +L G+ FGI NG VA++ + Sbjct: 80 LTGGIDLSVGPVMALSGTLTAGLMVAGLPPGL---AIGAGMLIGVAFGIGNGLFVAYLHM 136 Query: 138 PPFIVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWLVIIAFAVVAVSWF 197 PP IVTL T+ RGL + + I FAF G + G+ ++I V++ Sbjct: 137 PPIIVTLATMGIARGLGLMYTDGYPISGLPDWFAFFGRESLFGIQVPILIMLLTYLVAYV 196 Query: 198 VLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGL 257 +L+ T +G IYA+GGN EA RLSG++ L VY +SGL A + G++ ++RL + Sbjct: 197 LLQHTRIGRYIYAIGGNEEAVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQP- 255 Query: 258 QLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKG 317 G S+ELDAIAAV+LGG S GG G IVGTL+GA+++ VL+NGL +LGVS Q +IKG Sbjct: 256 NAGVSFELDAIAAVVLGGASIAGGRGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQSVIKG 315 Query: 318 LVIIGAVALDSYRRK 332 +I+ A+ + R K Sbjct: 316 GIILLAIFISRQRHK 330 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 330 Length adjustment: 28 Effective length of query: 309 Effective length of database: 302 Effective search space: 93318 Effective search space used: 93318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory