Align Fructose import permease protein FruG (characterized)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= SwissProt::Q8G845 (340 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 166 bits (421), Expect = 6e-46 Identities = 102/307 (33%), Positives = 167/307 (54%), Gaps = 14/307 (4%) Query: 24 PTLAAVVIFILMIIMGQALFGTYIRLGFISSLFIDHAYLIILAVAMTLPILTGGIDLSVG 83 P + VV+ ++MI+ T++ +S++ + I+AV MT ILTGGIDLSVG Sbjct: 34 PFVGLVVVTLVMILASD----TFLTASNLSNIARQVSINAIIAVGMTCVILTGGIDLSVG 89 Query: 84 AIVAITAVVGLKLANAGVPAFLVMIIMLLIGAVFGLLAGTLIEEFNMQPFIATLSTMFLA 143 ++A++ + L AG+P L + +LIG FG+ G + +M P I TL+TM +A Sbjct: 90 PVMALSGTLTAGLMVAGLPPGLAIGAGMLIGVAFGIGNGLFVAYLHMPPIIVTLATMGIA 149 Query: 144 RGLASIISTDSLTFPQGNDFSFISNVIKIIDNPKISNDLSFNVGVIIALVVVVFGYVFLH 203 RGL L + G S + + + V ++I L+ + YV L Sbjct: 150 RGLG-------LMYTDGYPISGLPDWFAFFGRESL---FGIQVPILIMLLTYLVAYVLLQ 199 Query: 204 HTRTGRTIYAIGGSRSSAELMGLPVKRTQYIIYLTSATLAALASIVYTANIGSAKNTVGV 263 HTR GR IYAIGG+ + L G+ R + ++Y S AA+A +V T+ + S + GV Sbjct: 200 HTRIGRYIYAIGGNEEAVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQPNAGV 259 Query: 264 GWELDAVASVVIGGTIITGGFGYVLGSVLGSLVRSILDPLTSDFGVPAEWTTIVIGLMIL 323 +ELDA+A+VV+GG I GG G ++G++LG+++ +L+ + GV +++ G +IL Sbjct: 260 SFELDAIAAVVLGGASIAGGRGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQSVIKGGIIL 319 Query: 324 VFVVLQR 330 + + + R Sbjct: 320 LAIFISR 326 Lambda K H 0.327 0.142 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 330 Length adjustment: 28 Effective length of query: 312 Effective length of database: 302 Effective search space: 94224 Effective search space used: 94224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory