GapMind for catabolism of small carbon sources

 

Alignments for a candidate for tpi in Pseudomonas simiae WCS417

Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate GFF4691 PS417_24000 triosephosphate isomerase

Query= BRENDA::P0A858
         (255 letters)



>FitnessBrowser__WCS417:GFF4691
          Length = 251

 Score =  234 bits (598), Expect = 1e-66
 Identities = 125/250 (50%), Positives = 165/250 (66%), Gaps = 2/250 (0%)

Query: 1   MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM 60
           MR  +V GNWK++G+R  V EL++ LR  LA  +G  VA+ PP ++I+      +G  I 
Sbjct: 1   MRRTMVAGNWKMHGTRASVAELINGLR-HLALPSGVDVAVFPPCLHINQVVDGLKGKSIQ 59

Query: 61  LGAQNVDLN-LSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQ 119
           +GAQN  +  + GA TGE S + L D G  Y+++GHSERR    E D  + +KFA  +  
Sbjct: 60  VGAQNSAVEPMQGALTGEISPSQLVDAGCSYVLVGHSERRQMMGERDGTLNRKFAAAQAC 119

Query: 120 GLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSAT 179
           GL PVLCIGET  + E+GKT EV +RQ+ ++++  G  AF  AVIAYEPVWAIGTG +AT
Sbjct: 120 GLIPVLCIGETLEQRESGKTLEVVSRQLGSIIEELGVGAFAKAVIAYEPVWAIGTGLTAT 179

Query: 180 PAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKA 239
           P QAQ VH  IR  +A  ++ +A+ V + YGGSV A+NA ELF  PDIDG L+GGASL A
Sbjct: 180 PQQAQDVHAAIRAQLAAENSEVAQGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNA 239

Query: 240 DAFAVIVKAA 249
           D F  I +AA
Sbjct: 240 DEFGAICRAA 249


Lambda     K      H
   0.316    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 177
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 255
Length of database: 251
Length adjustment: 24
Effective length of query: 231
Effective length of database: 227
Effective search space:    52437
Effective search space used:    52437
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 46 (22.3 bits)

Align candidate GFF4691 PS417_24000 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00419.hmm
# target sequence database:        /tmp/gapView.11205.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00419  [M=228]
Accession:   TIGR00419
Description: tim: triose-phosphate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    1.6e-68  217.0   0.5    1.8e-68  216.8   0.5    1.0  1  lcl|FitnessBrowser__WCS417:GFF4691  PS417_24000 triosephosphate isom


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF4691  PS417_24000 triosephosphate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.8   0.5   1.8e-68   1.8e-68       1     228 []       5     240 ..       5     240 .. 0.95

  Alignments for each domain:
  == domain 1  score: 216.8 bits;  conditional E-value: 1.8e-68
                           TIGR00419   1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdav.ksGaftGei 73 
                                         +v +n+K+++++ +v+++++ l+ ++a ++gv vav pp ++++ v+d ++   iqv+Aqn  +   +Ga tGei
  lcl|FitnessBrowser__WCS417:GFF4691   5 MVAGNWKMHGTRASVAELINGLR-HLALPSGVDVAVFPPCLHINQVVDGLKgKSIQVGAQNSAVEpMQGALTGEI 78 
                                         699******************98.69*************************999*******9987368******* PP

                           TIGR00419  74 sAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaaaA.. 146
                                         s   l+d+G+ +vl+gHsErR ++ e d  ++ k+a +++ gl +v+C+getle+re+++t+++v ++ + +   
  lcl|FitnessBrowser__WCS417:GFF4691  79 SPSQLVDAGCSYVLVGHSERRQMMGERDGTLNRKFAAAQACGLIPVLCIGETLEQRESGKTLEVVSRQLGSIIee 153
                                         *********************************************************888888887777666555 PP

                           TIGR00419 147 .....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaelaaqldvd 216
                                              + ++v+A+EPv++iGtG ++++ +a+ v++ +r  l+  + eva+ vr+lyG+sv+aa+++el+  +d+d
  lcl|FitnessBrowser__WCS417:GFF4691 154 lgvgaFAKAVIAYEPVWAIGTGLTATPQQAQDVHAAIRAQLAAENSEVAQGVRLLYGGSVKAANAVELFGMPDID 228
                                         55555********************************************************************** PP

                           TIGR00419 217 GvLlasavlkae 228
                                         G L+++a+l a+
  lcl|FitnessBrowser__WCS417:GFF4691 229 GGLIGGASLNAD 240
                                         *********997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (228 nodes)
Target sequences:                          1  (251 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 6.80
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory