Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate GFF2835 PS417_14475 2-hydroxyacid dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__WCS417:GFF2835 Length = 317 Score = 141 bits (355), Expect = 2e-38 Identities = 105/309 (33%), Positives = 154/309 (49%), Gaps = 36/309 (11%) Query: 26 ELHFQQAHLQADTAVLAQ---GFEVVCAFVNDDL-------SRPVLERLAAGGTRLVALR 75 ++HF + DTA + + GFEV+C P L+ L GG R A Sbjct: 29 QVHFLHDY-PTDTATMIERLKGFEVICVMRERSTFDKALLQGLPKLKLLVTGGMRNAA-- 85 Query: 76 SAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTREGDFSLH 135 +DL AA ALG+ V +Y HA E LI+ R L N R G + + Sbjct: 86 ------IDLPAARALGITVCGTDSYK-HAAPELTWALIMASTRNLLAEANALRAGHWQV- 137 Query: 136 GLTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNPRIQALGG-RYLALDAL 194 GL G DL+GK +GV+G G IG+ A+ FG ++A+ P A G +++ AL Sbjct: 138 GLGG-DLYGKTLGVLGLGSIGQKVAKFAQVFGMRVIAWSENLTPERAAESGVTWVSKQAL 196 Query: 195 LAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAALIEALKSGQLGY 254 ++DI+++H L+ +R L+DA+ L MKP A L+NT RG +V+ +AL+ AL+SG+L Sbjct: 197 FEQADILTVHLVLSDRSRGLVDAEALGWMKPSARLVNTARGPIVDESALVRALESGRLAG 256 Query: 255 LGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREALAAIADTTLDN 314 LDVY EE PL D R L PNV+ T H +++ + +++ Sbjct: 257 AALDVYTEE-----------PLPVDHPFRRL--PNVLATPHVGYVSEQNYRQFYAQMIED 303 Query: 315 IAAWQDGTP 323 I AW +G P Sbjct: 304 IQAWANGAP 312 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 317 Length adjustment: 28 Effective length of query: 301 Effective length of database: 289 Effective search space: 86989 Effective search space used: 86989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory