Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate GFF2397 PS417_12220 hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__WCS417:GFF2397 Length = 255 Score = 222 bits (566), Expect = 5e-63 Identities = 117/255 (45%), Positives = 159/255 (62%), Gaps = 5/255 (1%) Query: 1 MNLNSIPAFDDNYIWVLNDEAG-RCLIVDPGDAEPVLNAIAAN-NWQPEAIFLTHHHHDH 58 + ++++PAF DNYIW+L D + RC +VDPGDA PVL + N W I +THHHHDH Sbjct: 2 IQISALPAFTDNYIWLLQDPSTQRCAVVDPGDAAPVLAWLKQNPEWALSDILITHHHHDH 61 Query: 59 VGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHICYF 118 VGGV+ L ++ VYGP + + D + VLG +F + PGHTLGHI ++ Sbjct: 62 VGGVEHL-KRVTDAKVYGPANEKIPARDVALNDNDRISVLGWDFDIYTVPGHTLGHIAFY 120 Query: 119 SKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSI 178 LFCGDTLF+ GCGRLFEGT +QM+ SL+ L+ALP DTLV C HEYT SN+KFA ++ Sbjct: 121 HLGVLFCGDTLFAAGCGRLFEGTPAQMHTSLESLAALPADTLVYCTHEYTQSNLKFAQAV 180 Query: 179 LPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLL--QQ 236 P + I V++LR + +ITLP L E++ N FLRT + + +E + + Sbjct: 181 EPDNADIAQRVEIVRQLRERGEITLPSNLALEKRTNPFLRTSETSVKQKADERSGRDNRS 240 Query: 237 PEERFAWLRSKKDRF 251 E FA LR+ KD+F Sbjct: 241 GAEVFASLRAWKDKF 255 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 255 Length adjustment: 24 Effective length of query: 227 Effective length of database: 231 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate GFF2397 PS417_12220 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.3315.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-108 346.9 0.0 3.4e-108 346.7 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF2397 PS417_12220 hydroxyacylglutathio Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF2397 PS417_12220 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 346.7 0.0 3.4e-108 3.4e-108 1 248 [] 4 255 .] 4 255 .] 0.98 Alignments for each domain: == domain 1 score: 346.7 bits; conditional E-value: 3.4e-108 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeek.glkleaillTHhHaDHvggvaellekfpvkvvg 73 i a+pa++dNyiwll+d+++ +++vvDpg+a+pvl++l+++ ++ l++il+THhH+DHvggv++l++ +++kv+g lcl|FitnessBrowser__WCS417:GFF2397 4 ISALPAFTDNYIWLLQDPSTqRCAVVDPGDAAPVLAWLKQNpEWALSDILITHHHHDHVGGVEHLKRVTDAKVYG 78 5789***************99*****************99879******************************** PP TIGR03413 74 paeeripgltkevkegdevellelevevlevpGHtlgHiayyleeekvlFcgDtLfsaGCGrlfegtaeqmlesl 148 pa+e+ip+ +++++++d++++l+ ++++++vpGHtlgHia+y +vlFcgDtLf+aGCGrlfegt++qm++sl lcl|FitnessBrowser__WCS417:GFF2397 79 PANEKIPARDVALNDNDRISVLGWDFDIYTVPGHTLGHIAFYHL--GVLFCGDTLFAAGCGRLFEGTPAQMHTSL 151 ******************************************99..***************************** PP TIGR03413 149 qklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeeaev 223 + laaLp++t+vyc+HEYt+sNl+Fa+avep+n+++++r++ v++lr++g++tlPs+la ek+tNpFLr++e++v lcl|FitnessBrowser__WCS417:GFF2397 152 ESLAALPADTLVYCTHEYTQSNLKFAQAVEPDNADIAQRVEIVRQLRERGEITLPSNLALEKRTNPFLRTSETSV 226 *************************************************************************** PP TIGR03413 224 kaalee....ekaeevevfaelRekkdkf 248 k++++e ++++ +evfa+lR++kdkf lcl|FitnessBrowser__WCS417:GFF2397 227 KQKADErsgrDNRSGAEVFASLRAWKDKF 255 ****99999888999************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (255 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 6.78 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory