GapMind for catabolism of small carbon sources

 

Aligments for a candidate for serP1 in Pseudomonas simiae WCS417

Align Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized)
to candidate GFF4632 PS417_23700 aromatic amino acid transporter

Query= TCDB::F2HQ25
         (459 letters)



>lcl|FitnessBrowser__WCS417:GFF4632 PS417_23700 aromatic amino acid
           transporter
          Length = 467

 Score =  300 bits (768), Expect = 7e-86
 Identities = 165/433 (38%), Positives = 254/433 (58%), Gaps = 28/433 (6%)

Query: 11  QRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGPSVIFAYILIGIAMFFFLRTIGEMLY 70
           +RGL+NRHIQLIA+ G IGTGLFLG+   ++  GPS+I  Y + G   F  +R +GEM+ 
Sbjct: 12  KRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMIV 71

Query: 71  NDPSQHSFLNFVTKYSGVRTGYFTQWSYWLVIVFVCISELTAIGTYIQFWLPQVPLWLIE 130
            +P   SF +F  KY G   G+   W+YW++ V V ++ELTA+G YIQFW P +P W+  
Sbjct: 72  EEPVAGSFSHFAHKYWGGYAGFLAGWNYWVLYVLVGMAELTAVGKYIQFWWPDIPTWVSA 131

Query: 131 IVMLALLFGLNTLNSRFFGETEFWFAMIKVAAIIGMIVTAIILVAGNFHYSTVLSGKTVH 190
           +V    +  +NTLN +FFGETEFWFA+IKV AI+GMIV    L          L   T  
Sbjct: 132 LVFFVAVNLINTLNVKFFGETEFWFAIIKVVAIVGMIVLGCYL----------LFSGTGG 181

Query: 191 DSASLSNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPKKSLPKAINQI 250
             AS+SN++     FP+G    + ++  +MF+F  +E +G+TAAE   P+K +PKAINQ+
Sbjct: 182 PQASVSNLWSHGGFFPNGGMGLLMSMAFIMFSFGGLELVGITAAEASEPRKVIPKAINQV 241

Query: 251 PVRILLFYVGALLAIMAIFNWHYI---------PADKSPFVMVFQLIGIKWAAALINFVV 301
             RIL+FYVGAL  +++++ W  +             SPFV +F LIG   AA ++NFVV
Sbjct: 242 VYRILIFYVGALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFSLIGNDTAAHILNFVV 301

Query: 302 LTSAASALNSSLFSATRNMYSLAQQHDKGRLTPFTKLSKAGIPINALYMATALSLLAPVL 361
           LT+A S  NS ++  +R ++ LA+Q D  +     KL+K G+PI AL ++  +++L  V+
Sbjct: 302 LTAALSVYNSGVYCNSRMLFGLAEQGDAPK--SLMKLNKQGVPIRALAISALVTMLCVVV 359

Query: 362 TLIPQIKNAFDFAASCTTNLFLVVYFITLYTYWQYRKS---EDYNP--KGFLTP-KPQIT 415
             +   ++A +   +      ++ + +   T+ ++RK+   +   P  K F  P    + 
Sbjct: 360 NYVAP-QSALELLFALVVASLMINWALISITHIKFRKAMGEQGVTPSFKTFWFPFSNYLC 418

Query: 416 VPFIVAIFAIVFA 428
           + F+V I +++ A
Sbjct: 419 LAFMVMIISVMLA 431


Lambda     K      H
   0.329    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 594
Number of extensions: 33
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 459
Length of database: 467
Length adjustment: 33
Effective length of query: 426
Effective length of database: 434
Effective search space:   184884
Effective search space used:   184884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory