Align L-threonine dehydratase biosynthetic IlvA; EC 4.3.1.19; Threonine deaminase (uncharacterized)
to candidate GFF2483 PS417_12665 hypothetical protein
Query= curated2:P37946 (422 letters) >FitnessBrowser__WCS417:GFF2483 Length = 340 Score = 235 bits (599), Expect = 2e-66 Identities = 132/320 (41%), Positives = 188/320 (58%), Gaps = 7/320 (2%) Query: 13 VKHILKAHQNVKDVVIHTPLQRNDRLSERYECNIYLKREDLQVVRSFKLRGAYHKMKQLS 72 VK IL A V D+ + TPLQ LS + LKREDLQ SFK+RGAY+K+ QL+ Sbjct: 19 VKKILAAP--VYDLAVRTPLQAAPALSALLGNQVLLKREDLQPTFSFKIRGAYNKLVQLT 76 Query: 73 SEQTENGVVCASAGNHAQGVAFSCKHLGIHGKIFMPSTTPRQKVSQVELFGKGFIDIILT 132 EQ GVV ASAGNHAQGVA + + LGI +I MP++TP KV V G +L Sbjct: 77 PEQRARGVVTASAGNHAQGVALAARELGIKARIVMPASTPELKVLGVRSRGA---QAVLH 133 Query: 133 GDTFDDVYKSAAECCEAESRTFIHPFDDPDVMAGQGTLAVEILNDIDTEPHFLFASVGGG 192 G +F A + E+ TF+ PFDDPDV+AGQGT+A+EIL +F VGGG Sbjct: 134 GASFPFALAYALQLAESSGCTFVSPFDDPDVIAGQGTVAMEILRQQQGPLDAIFVPVGGG 193 Query: 193 GLLSGVGTYLKNVSPDTKVIAVEPAGAASYFESNKAGHVVTLDKIDKFVDGAAVKKIGEE 252 GL++GV Y+K + PD ++I VEP G++ + +AG V L +D F DG AV ++G Sbjct: 194 GLIAGVAAYVKYLRPDVRIIGVEPEGSSCLLAALRAGERVVLPSVDGFADGTAVAQVGAH 253 Query: 253 TFRTLETVVDDILLVPEGKVCTSILELYNECAVVAEPAGALSVAALDLY--KDQIKGKNV 310 F VD+++ V +C++I +Y++ + EP+GAL+VA + Y ++G+ + Sbjct: 254 GFEICRDWVDEVITVSNDALCSAIKLIYDDTRSITEPSGALAVAGIRQYVATHNLRGQTL 313 Query: 311 VCVVSGGNNDIGRMQEMKER 330 V + SG N + ++ + ER Sbjct: 314 VAINSGANINFDSLRHVAER 333 Lambda K H 0.318 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 340 Length adjustment: 30 Effective length of query: 392 Effective length of database: 310 Effective search space: 121520 Effective search space used: 121520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF2483 PS417_12665 (hypothetical protein)
to HMM TIGR01124 (ilvA: threonine ammonia-lyase, biosynthetic (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01124.hmm # target sequence database: /tmp/gapView.4349.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01124 [M=499] Accession: TIGR01124 Description: ilvA_2Cterm: threonine ammonia-lyase, biosynthetic Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-150 486.7 0.7 4.5e-150 486.4 0.7 1.0 1 lcl|FitnessBrowser__WCS417:GFF2483 PS417_12665 hypothetical protein Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF2483 PS417_12665 hypothetical protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 486.4 0.7 4.5e-150 4.5e-150 2 318 .. 18 334 .. 17 338 .. 0.99 Alignments for each domain: == domain 1 score: 486.4 bits; conditional E-value: 4.5e-150 TIGR01124 2 ylrailkarvyeaavetplekaaklserlknrvllkredlqpvfsfklrGaynkmaqlsaeqkakGviaasaGnh 76 y+++il a vy+ av tpl+ a ls+ l+n+vllkredlqp fsfk+rGaynk+ ql++eq+a+Gv++asaGnh lcl|FitnessBrowser__WCS417:GFF2483 18 YVKKILAAPVYDLAVRTPLQAAPALSALLGNQVLLKREDLQPTFSFKIRGAYNKLVQLTPEQRARGVVTASAGNH 92 899************************************************************************ PP TIGR01124 77 aqGvalsakklGvkavivmpettpeikvdavkafGgevvlhGenydeakakalelaqekgltfiapfddplviaG 151 aqGval+a++lG+ka ivmp++tpe+kv v+++G++ vlhG+++ a a+al+la+ g tf++pfddp+viaG lcl|FitnessBrowser__WCS417:GFF2483 93 AQGVALAARELGIKARIVMPASTPELKVLGVRSRGAQAVLHGASFPFALAYALQLAESSGCTFVSPFDDPDVIAG 167 *************************************************************************** PP TIGR01124 152 qGtvalellrqveedldavfvpvGGGGliaGvaalvkqllpeikvigveaedsaalkqaleaGervkldqvGlfa 226 qGtva+e+lrq++ +lda+fvpvGGGGliaGvaa+vk l+p++++igve+e s++l +al aGerv l +v fa lcl|FitnessBrowser__WCS417:GFF2483 168 QGTVAMEILRQQQGPLDAIFVPVGGGGLIAGVAAYVKYLRPDVRIIGVEPEGSSCLLAALRAGERVVLPSVDGFA 242 *************************************************************************** PP TIGR01124 227 dGvavkevGdetfrlckeylddivlvdtdevcaaikdvfedtravlepaGalalaGlkkyvakkgiedktlvail 301 dG+av +vG++ f++c++++d++++v d++c+aik +++dtr+++ep+Gala+aG+++yva+++++++tlvai+ lcl|FitnessBrowser__WCS417:GFF2483 243 DGTAVAQVGAHGFEICRDWVDEVITVSNDALCSAIKLIYDDTRSITEPSGALAVAGIRQYVATHNLRGQTLVAIN 317 *************************************************************************** PP TIGR01124 302 sGanlnfdrlryvsera 318 sGan+nfd+lr+v+er lcl|FitnessBrowser__WCS417:GFF2483 318 SGANINFDSLRHVAERV 334 ****************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (499 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.60 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory