Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate GFF3461 PS417_17720 iditol 2-dehydrogenase
Query= BRENDA::O58389 (348 letters) >FitnessBrowser__WCS417:GFF3461 Length = 359 Score = 162 bits (410), Expect = 1e-44 Identities = 114/343 (33%), Positives = 173/343 (50%), Gaps = 25/343 (7%) Query: 19 LVEVDVPKPGPGEVLIKVLATSICGTDLHIYE-----W---NEWAQSRIKPPQIMGHEVA 70 L + P+ E++I++ A IC +D + W N W +K P + GHE Sbjct: 20 LERIGKPQARANELVIRIAACGICASDCKCHSGAAMFWGGDNPW----VKAPVVPGHEFF 75 Query: 71 GEVVEIGPGVEG---IEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVD---TDGV 124 G VVE G G E + VGD V E + CGKC C+ G+Y +C+ IFG +G Sbjct: 76 GYVVEAGEGAEEHFEVAVGDKVIAEQIVPCGKCRFCKSGKYWMCEVHNIFGFQREVAEGG 135 Query: 125 FAEYAVVPAQNI-WKNPKSIPPEYATLQEPLGNAVDTVLAGPIS-GKSVLITGAGPLGLL 182 A+Y +P I K P+S+ E + L EP+ ++ TV G I V+I GAG LGL Sbjct: 136 MAQYMRIPKTAIVHKIPESVSLEDSALVEPMACSIHTVNRGDIQLDDVVVIAGAGTLGLC 195 Query: 183 GIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITDGNGVDVFLE 242 + VA ++V + D R ELAKK GAD VINP ++ + + +TD G DV++E Sbjct: 196 MVQVAALKTPKKLVVIDMVDERLELAKKFGADVVINPSRDNAREIINGLTDNYGCDVYIE 255 Query: 243 FSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWETWYT 302 +G P + QGL + GR ++ + ++D++ + K L + G HL Y Sbjct: 256 TTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSVDWSIIGDRKEL---DVRGAHLGPYCYP 312 Query: 303 VS-RLLQSGKLNLDPIITHKYKGFDKYEEAFELMRAGKTGKVV 344 ++ L + G + I+TH + D + EAFEL + K+ KV+ Sbjct: 313 IAIDLFERGLVTSKGIVTHDFP-LDDWAEAFELANSTKSIKVL 354 Lambda K H 0.318 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 359 Length adjustment: 29 Effective length of query: 319 Effective length of database: 330 Effective search space: 105270 Effective search space used: 105270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory