GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mglA in Pseudomonas simiae WCS417

Align Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate GFF3463 PS417_17730 ribonucleotide-diphosphate reductase subunit alpha

Query= TCDB::G4FGN3
         (494 letters)



>lcl|FitnessBrowser__WCS417:GFF3463 PS417_17730
           ribonucleotide-diphosphate reductase subunit alpha
          Length = 502

 Score =  407 bits (1045), Expect = e-118
 Identities = 219/495 (44%), Positives = 324/495 (65%), Gaps = 3/495 (0%)

Query: 1   MKPILEVKSIHKRFPGVHALKGVSMEFYPGEVHAIVGENGAGKSTLMKIIAGVYQPDEGE 60
           M  +L++++I KR+PGV ALK ++++   GE+HA++GENGAGKSTLMKI+ GV   DEG+
Sbjct: 1   MSSLLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQDEGQ 60

Query: 61  IIYEGRGVRWNHPSEAINAGIVTVFQELSVMDNLSVAENIFMGDEEKRGIFIDYKKMYRE 120
           I+ +G+  ++    +AI AGI  VFQE S++  L+  ENIF+G E      +  K+   E
Sbjct: 61  ILIDGQAQQFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHELSNRFGLLRKREMVE 120

Query: 121 AEKFMKEEFGIEIDPEEKLGKYSIAIQQMVEIARAVYKKAKVLILDEPTSSLTQKETEKL 180
           A + + +  G+ ID +  +   S+A QQ VEIA+A+   A++L+LDEPT++LT  E E L
Sbjct: 121 ASEALFKRLGVTIDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPSEAELL 180

Query: 181 FEVVKSLKEKGVAIIFISHRLEEIFEICDKVSVLRDGEYIGTDSIENLTKEKIVEMMVGR 240
           FE+++ LK +GVA+IFISH LEEIF++CD++SVLRDG  +G   + +   + +VEMMVGR
Sbjct: 181 FEIMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDIDHLVEMMVGR 240

Query: 241 KLE-KFYIKEAHEPGEVVLEVKNLSGER-FENVSFSLRRGEILGFAGLVGAGRTELMETI 298
           +L   F  K   E G ++LEVK++   R   +  F L +GEILGFAGLVG+GRTEL   +
Sbjct: 241 RLACSFPPKPTRERGPLLLEVKDIQLVRNGPHNRFQLHKGEILGFAGLVGSGRTELALGM 300

Query: 299 FGFRPKRGGEIYIEGKRVEINHPLDAIEQGIGLVPEDRKKLGLILIMSIMHNVSLPSLDR 358
            G  P    ++++ G+++ ++ P  A+  GIGL+PE RK  GLI   SI  N+SL +L +
Sbjct: 301 MGALPSVSKDVWLRGEKITLDDPAQALAHGIGLLPESRKSEGLITDFSIRENISLNNLPK 360

Query: 359 IKKGP-FISFKREKELADWAIKTFDIRPAYPDRKVLYLSGGNQQKVVLAKWLALKPKILI 417
            +     I   RE    +  +K   I+    + +V  LSGGNQQKVV+A+W+     +L+
Sbjct: 361 YQNASGLIDKNRECASVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVIARWINHHCDVLV 420

Query: 418 LDEPTRGIDVGAKAEIYRIMSQLAKEGVGVIMISSELPEVLQMSDRIAVMSFGKLAGIID 477
            DEPTRGIDVGAKA+IY +M  L ++G  +IMISSELPE++ M DR+AV   G +  +++
Sbjct: 421 FDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVAVFHKGAIVKLLE 480

Query: 478 AKEASQEKVMKLAAG 492
           A   + ++VM+ A G
Sbjct: 481 ASAVNPQEVMRHATG 495



 Score = 75.5 bits (184), Expect = 4e-18
 Identities = 62/246 (25%), Positives = 108/246 (43%), Gaps = 10/246 (4%)

Query: 4   ILEVKSIHKRFPGVHALKGVSMEFYPGEVHAIVGENGAGKSTLMKIIAGVYQPDEGEIIY 63
           +LEVK I     G H       + + GE+    G  G+G++ L   + G       ++  
Sbjct: 258 LLEVKDIQLVRNGPHN----RFQLHKGEILGFAGLVGSGRTELALGMMGALPSVSKDVWL 313

Query: 64  EGRGVRWNHPSEAINAGIVTVFQELS---VMDNLSVAENIFMGDEEK---RGIFIDYKKM 117
            G  +  + P++A+  GI  + +      ++ + S+ ENI + +  K       ID  + 
Sbjct: 314 RGEKITLDDPAQALAHGIGLLPESRKSEGLITDFSIRENISLNNLPKYQNASGLIDKNRE 373

Query: 118 YREAEKFMKEEFGIEIDPEEKLGKYSIAIQQMVEIARAVYKKAKVLILDEPTSSLTQKET 177
               E  MK+        E ++   S   QQ V IAR +     VL+ DEPT  +     
Sbjct: 374 CASVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVIARWINHHCDVLVFDEPTRGIDVGAK 433

Query: 178 EKLFEVVKSLKEKGVAIIFISHRLEEIFEICDKVSVLRDGEYIGTDSIENLTKEKIVEMM 237
            +++ +++SL E+G AII IS  L EI  +CD+V+V   G  +       +  ++++   
Sbjct: 434 AQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVAVFHKGAIVKLLEASAVNPQEVMRHA 493

Query: 238 VGRKLE 243
            G   E
Sbjct: 494 TGGSSE 499


Lambda     K      H
   0.318    0.138    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 695
Number of extensions: 36
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 494
Length of database: 502
Length adjustment: 34
Effective length of query: 460
Effective length of database: 468
Effective search space:   215280
Effective search space used:   215280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory