GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aroP in Pseudomonas simiae WCS417

Align Aromatic amino acid transport protein AroP (characterized, see rationale)
to candidate GFF4632 PS417_23700 aromatic amino acid transporter

Query= uniprot:Q4KIP0
         (466 letters)



>lcl|FitnessBrowser__WCS417:GFF4632 PS417_23700 aromatic amino acid
           transporter
          Length = 467

 Score =  785 bits (2028), Expect = 0.0
 Identities = 387/445 (86%), Positives = 413/445 (92%)

Query: 10  LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMI 69
           LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMI
Sbjct: 11  LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMI 70

Query: 70  VEEPVAGSFSHFAHKYWGGYFGFLAGWNYWVLYVLVGMAELTAVGKYVQFWWPEIPTWVS 129
           VEEPVAGSFSHFAHKYWGGY GFLAGWNYWVLYVLVGMAELTAVGKY+QFWWP+IPTWVS
Sbjct: 71  VEEPVAGSFSHFAHKYWGGYAGFLAGWNYWVLYVLVGMAELTAVGKYIQFWWPDIPTWVS 130

Query: 130 AAVFFVLVNLINMMNVKFFGEAEFWFAIIKVVAIVGMIVLGCYMLFSGSGGSQASVSNLW 189
           A VFFV VNLIN +NVKFFGE EFWFAIIKVVAIVGMIVLGCY+LFSG+GG QASVSNLW
Sbjct: 131 ALVFFVAVNLINTLNVKFFGETEFWFAIIKVVAIVGMIVLGCYLLFSGTGGPQASVSNLW 190

Query: 190 SHGGFFPNGGTGLLMAMAFIMFSFGGLELVGITAAEAAEPRKVIPKAINQVVYRVLIFYV 249
           SHGGFFPNGG GLLM+MAFIMFSFGGLELVGITAAEA+EPRKVIPKAINQVVYR+LIFYV
Sbjct: 191 SHGGFFPNGGMGLLMSMAFIMFSFGGLELVGITAAEASEPRKVIPKAINQVVYRILIFYV 250

Query: 250 GALAVLLSLYPWDELLVSLNAGGDAYSSSPFVKIFSLIGSDAAAQILNFVVLTAALSVYN 309
           GAL VLLSLYPWD+LL +L A GDAYS SPFV+IFSLIG+D AA ILNFVVLTAALSVYN
Sbjct: 251 GALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFSLIGNDTAAHILNFVVLTAALSVYN 310

Query: 310 SGVYCNSRMLYGLAEQGDAPKALMKLNKQGVPILALGISALITLLCVLVNYLAPHEALEL 369
           SGVYCNSRML+GLAEQGDAPK+LMKLNKQGVPI AL ISAL+T+LCV+VNY+AP  ALEL
Sbjct: 311 SGVYCNSRMLFGLAEQGDAPKSLMKLNKQGVPIRALAISALVTMLCVVVNYVAPQSALEL 370

Query: 370 LFALVVAALMINWALISLTHLRFRKAMAEQGVVPSFKAFWSPLSNYLCLAFMVMIVGVMW 429
           LFALVVA+LMINWALIS+TH++FRKAM EQGV PSFK FW P SNYLCLAFMVMI+ VM 
Sbjct: 371 LFALVVASLMINWALISITHIKFRKAMGEQGVTPSFKTFWFPFSNYLCLAFMVMIISVML 430

Query: 430 MIPGIRASVYAIPVWVLVIWGFYLL 454
            IPGI  SVYA+PVWV +I+  Y L
Sbjct: 431 AIPGISESVYAMPVWVGIIYVAYRL 455


Lambda     K      H
   0.327    0.141    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 880
Number of extensions: 39
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 466
Length of database: 467
Length adjustment: 33
Effective length of query: 433
Effective length of database: 434
Effective search space:   187922
Effective search space used:   187922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory