Align Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (characterized)
to candidate GFF4633 PS417_23705 tryptophan 2,3-dioxygenase
Query= reanno::WCS417:GFF4633 (285 letters) >FitnessBrowser__WCS417:GFF4633 Length = 285 Score = 582 bits (1501), Expect = e-171 Identities = 285/285 (100%), Positives = 285/285 (100%) Query: 1 MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT 60 MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT Sbjct: 1 MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT 60 Query: 61 SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKSIR 120 SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKSIR Sbjct: 61 SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKSIR 120 Query: 121 PFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSLYDEAINLMI 180 PFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSLYDEAINLMI Sbjct: 121 PFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSLYDEAINLMI 180 Query: 181 QAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWR 240 QAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWR Sbjct: 181 QAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWR 240 Query: 241 FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL 285 FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL Sbjct: 241 FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL 285 Lambda K H 0.321 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 285 Length adjustment: 26 Effective length of query: 259 Effective length of database: 259 Effective search space: 67081 Effective search space used: 67081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate GFF4633 PS417_23705 (tryptophan 2,3-dioxygenase)
to HMM TIGR03036 (kynA: tryptophan 2,3-dioxygenase (EC 1.13.11.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03036.hmm # target sequence database: /tmp/gapView.22162.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03036 [M=264] Accession: TIGR03036 Description: trp_2_3_diox: tryptophan 2,3-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-131 424.1 0.0 1.2e-131 423.9 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF4633 PS417_23705 tryptophan 2,3-dioxy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF4633 PS417_23705 tryptophan 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.9 0.0 1.2e-131 1.2e-131 1 264 [] 22 285 .] 22 285 .] 1.00 Alignments for each domain: == domain 1 score: 423.9 bits; conditional E-value: 1.2e-131 TIGR03036 1 dfsesmsYgdYlkldellsaqkplsedhdemlfivqhqvselwlklilheleaaaralradeleaalkalaRvsr 75 +fsesmsYgdYl+l ++lsaq+pls+dh+emlfi+qhq+selw+kl+lhel+aa++++r +el++a+k+laRvsr lcl|FitnessBrowser__WCS417:GFF4633 22 NFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQTSELWMKLMLHELKAAREHVRLGELPPAFKMLARVSR 96 69************************************************************************* PP TIGR03036 76 ileqlveaWdvLatltPaeysefRealgessGfqsyqyReiefllGnknaallkphekdpellaeleaaleePsl 150 i++qlv+aW vLat+tP+ey+++R++lg+ssGfqs+qyReief+lGnk+aall+ph+++pell+el+ a+++Psl lcl|FitnessBrowser__WCS417:GFF4633 97 IFDQLVHAWAVLATMTPSEYKSIRPFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSL 171 *************************************************************************** PP TIGR03036 151 YdevlrllarrGfaipaevlerdvtkpaeaneeveaawlevYrdaekewelyelaeklvDledlfrrWRfrhltt 225 Yde+++l+ ++G+ai+ ++ erd t ++ ++e+veaaw+evYrd++++w+ly+laek++Dled+fr+WRfrh+tt lcl|FitnessBrowser__WCS417:GFF4633 172 YDEAINLMIQAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWRFRHVTT 246 *************************************************************************** PP TIGR03036 226 veRiiGfkrGtGGssGvayLkkaldvelfPelwkvRtel 264 veRiiGf+ GtGG++Gv yL+k+ld++lfPelw+vR++l lcl|FitnessBrowser__WCS417:GFF4633 247 VERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL 285 ************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (264 nodes) Target sequences: 1 (285 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.51 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory