Align 2-amino-5-chloromuconic acid deaminase; 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate GFF835 PS417_04240 glutamyl-tRNA amidotransferase
Query= SwissProt::Q38M35 (462 letters) >FitnessBrowser__WCS417:GFF835 Length = 483 Score = 166 bits (420), Expect = 2e-45 Identities = 136/471 (28%), Positives = 210/471 (44%), Gaps = 40/471 (8%) Query: 5 HLSLAEHAARLRRRELTAVALIDTCAQHHARMEPRLNAYKTWDGARARSAAAAVDTLLDQ 64 H++LAE A L + ++ L T A +P++N++ + A S A A D Sbjct: 3 HMTLAEIARGLADKTFSSEELTKTLLARIAEHDPKVNSFISLTEELALSQAKAADARRAN 62 Query: 65 GQDLGPLMGLPVSVKDLYGVPGLPVFAGSDEALPEAWQAAGPLVARLQRQLGIVVGKTHT 124 G+ G L+G P++ KDL+ G+ GS +V++L + +GKT+ Sbjct: 63 GES-GALLGAPIAHKDLFCTQGIRTSCGSKMLDNFKAPYDATVVSKLAAAGAVTLGKTNM 121 Query: 125 VEFAFGGLGVNAHWGTPRNPWSPHEHRVPGGSSAGAGVSLVQGSALLALGTDTAGSVRVP 184 EFA G ++++G +NPW+ VPGGSS G+ ++ A TDT GS+R P Sbjct: 122 DEFAMGSANESSYYGAVKNPWNLDH--VPGGSSGGSAAAVAARFLPAATATDTGGSIRQP 179 Query: 185 ASMTGQVGLKTTVGRWPVEGIVPLSSSLDTAGVLTRTVEDLAYAFAAL----DTESQGLP 240 A+ T GLK T GR G++ +SSLD G L RT ED A + +S + Sbjct: 180 AAFTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCAILLQGMAGFDKQDSTSID 239 Query: 241 APAP-------VRVQGLRVGVPTNHFWDDIDPSIAAAVEAAVQRLAQAGAQVVRFPLPHC 293 P P ++GLR+GVP +F +DP IA V +V+ L GA + LP+ Sbjct: 240 EPVPDYSASLNTSLKGLRIGVPKEYFSAGLDPRIAELVHNSVKTLESLGAVIKEISLPNN 299 Query: 294 EEAFDIFR--RGGLAASELAAYLDQHFPHKVER---------------LDPVVRDRVRWA 336 + A + A+S L+ + F ++ E V+ R+ Sbjct: 300 QHAIPAYYVIAPAEASSNLSRFDGVRFGYRCENPKDLTDLYKRSRGEGFGAEVQRRIMVG 359 Query: 337 EQVSS-----VEYLRRKAVLQRCGAGAARLFDDVDVLLTPTVPASPPRLADIGTVETYAP 391 S YL+ + + + F++VDV+L PT P + IG Sbjct: 360 AYALSAGYYDAYYLKAQKIRRLIKNDFMAAFEEVDVILGPTTPNPAWK---IGAKTGDPI 416 Query: 392 ANMKAMRNTAISNLFGWCALTMPVGLDANRMPVGLQLMGPPRAEARLIGIA 442 A T +NL G L+MP G + +PVG+QL+ P E RL+ +A Sbjct: 417 AEYLEDLYTITANLAGLPGLSMPAGF-VDGLPVGVQLLAPYFQEGRLLNVA 466 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 23 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 462 Length of database: 483 Length adjustment: 33 Effective length of query: 429 Effective length of database: 450 Effective search space: 193050 Effective search space used: 193050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory