Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate GFF3281 PS417_16795 ABC transporter
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__WCS417:GFF3281 Length = 257 Score = 191 bits (484), Expect = 2e-53 Identities = 103/254 (40%), Positives = 153/254 (60%), Gaps = 5/254 (1%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 ++ +L+V IS F G++A++ + + RG++ LIGPNGAGK++ NV+ G+Y DAG Sbjct: 2 SQAILQVRDISLSFKGIKAINALSFEVARGEICALIGPNGAGKSSLLNVLNGVYRFDAGE 61 Query: 66 FELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVG--RHIRTGSGLFGAVFR 123 + + A+ GI RTFQN LF +M+ L+N++ G RH+R S + Sbjct: 62 IVFEDQHFHRIDPLGAARRGIGRTFQNNALFKKMSVLDNILTGLSRHMR--SSVIEQALG 119 Query: 124 TKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDE 183 + E A RAQ +L+++ + D LSYG Q+R+E+ RAL P L+ LDE Sbjct: 120 LPRARREAEAFRLRAQGILEFLELQAHRDVLVGNLSYGLQKRVELGRALIAGPSLLLLDE 179 Query: 184 PAAGMNATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPA 242 P AGMNA EK ++ + + D T++LIEHD+ +VMGL D V VLDYG+++ +G PA Sbjct: 180 PMAGMNAEEKQEMARFVADVNRDLGTTVVLIEHDMGVVMGLSDHVVVLDYGRKVGDGTPA 239 Query: 243 EVQKNEKVIEAYLG 256 +VQ N +VI AYLG Sbjct: 240 DVQANPEVIAAYLG 253 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory