Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate GFF524 PS417_02670 ABC transporter
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__WCS417:GFF524 Length = 291 Score = 216 bits (549), Expect = 6e-61 Identities = 120/283 (42%), Positives = 166/283 (58%), Gaps = 31/283 (10%) Query: 5 SNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAG 64 S EVVL V + FGG++ALSDV + ++R ++ LIGPNGAGKTT FN +TG Y G Sbjct: 2 SKEVVLSVEHLMMHFGGIKALSDVSLKVERNSIFALIGPNGAGKTTVFNCLTGFYKASGG 61 Query: 65 TFEL------------AGKPYEPT------------------AVHEVAKAGIARTFQNIR 94 EL G+ ++PT H V +AG+ARTFQNIR Sbjct: 62 KIELNIRGKRTNVIQLLGERFQPTDFVSPKRFFSRVFYKMFGGTHWVNRAGLARTFQNIR 121 Query: 95 LFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFKAEEAAIAKRAQELLDYVGIGKFADYK 154 LF EM+ +EN++V +H+ + + TKG++ E+ A L+ V + A+ Sbjct: 122 LFKEMSVVENLLVAQHMWVNRNMLAGILNTKGYRKAESDALDHAFYWLEVVDLVDCANRL 181 Query: 155 ARTLSYGDQRRLEIARALATDPQLIALDEPAAGMNATEKVQLRELIDRIRND-NRTILLI 213 A LSYG QRRLEIARA+ T PQ+I LDEPAAG+N E L +I +R++ + T++LI Sbjct: 182 AGELSYGQQRRLEIARAMCTRPQIICLDEPAAGLNPQETEALSAMIRLLRDEHDLTVVLI 241 Query: 214 EHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNEKVIEAYLG 256 EHD+ +VM + D + VLD+G IAEG P ++ + KVI AYLG Sbjct: 242 EHDMGMVMSISDHIVVLDHGNVIAEGGPDAIRNDPKVIAAYLG 284 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 291 Length adjustment: 25 Effective length of query: 235 Effective length of database: 266 Effective search space: 62510 Effective search space used: 62510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory