GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdC in Pseudomonas simiae WCS417

Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate GFF434 PS417_02215 dihydrolipoamide acetyltransferase

Query= reanno::Smeli:SMc03203
         (426 letters)



>lcl|FitnessBrowser__WCS417:GFF434 PS417_02215 dihydrolipoamide
           acetyltransferase
          Length = 548

 Score =  255 bits (652), Expect = 2e-72
 Identities = 164/430 (38%), Positives = 228/430 (53%), Gaps = 30/430 (6%)

Query: 6   IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65
           I +PD+G    +A+++E  VK GD V  D  L  + +DKA++EIPSP  G V  +  ++ 
Sbjct: 122 IHVPDIGSS-GKAKIIELLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLE 180

Query: 66  DTVAVKAPLVRIETAGEAGEAAPD--SIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAP 123
           D V     +++++  G A  AAP   + P A AE     P A +    AKA   P   A 
Sbjct: 181 DEVGTGDFILKLKVQGAAPAAAPAPAAAPAAKAEAA---PAAAAPAPAAKAEAAPAPAAA 237

Query: 124 KPAPAPREAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFIS---RG 180
            PAP+        AK  A PAVR  ARE G++L  V+ TGP GR+  ED+ +++    + 
Sbjct: 238 APAPS-------GAKVHAGPAVRQLAREFGVELSAVSATGPHGRVLKEDVQVYVKAMMQK 290

Query: 181 AEPLPAQTGLV--------------RKTAVEEVRMIGLRRRIAEKMSLSTSRIPHITYVE 226
           A+  PA  G                R   +EEV M  L +  A  +  S   IPH+T  +
Sbjct: 291 AKEAPAAGGATGGSGIPPIRTVDFSRFGEIEEVPMTRLMQIGAAGLHASWLNIPHVTQFD 350

Query: 227 EVDMTALEDLRATMNRDRKPEQAKLTILPFLMRALVKTVAEQPGVNATFDDHAGVIHRHA 286
           + D+T LE  R       +    KLT+LP L++A    + E P  NA+       I R  
Sbjct: 351 QADITDLEAFRVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNASLAPSGKAIIRKK 410

Query: 287 AVHIGIATQTPAGLTVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGSTITISS 346
            VHIG A  TP GL VPV+++ + + +   AAE   LA  AR    T D++ G+  TISS
Sbjct: 411 YVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAAKARDKKLTPDDMQGACFTISS 470

Query: 347 LGAIGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVIDGWDAA 406
           LG IGG   TP++N PEVAI+GV+K  ++PVWDG  F P+ ++ LS S+DHRVI+G  AA
Sbjct: 471 LGHIGGTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAA 530

Query: 407 VFVQRLKTLL 416
            F QRL  LL
Sbjct: 531 RFTQRLSQLL 540



 Score = 70.1 bits (170), Expect = 2e-16
 Identities = 46/129 (35%), Positives = 67/129 (51%), Gaps = 18/129 (13%)

Query: 5   IIKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEV 64
           +I++PD+G G  E E++E  VK GD V  D  +  + +DKA++EIP+P  G V  L  ++
Sbjct: 4   LIRVPDIGSG--EGEVIELFVKVGDTVEADQSILTLESDKASMEIPAPKAGVVKSLKVKL 61

Query: 65  GDTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAPK 124
           GD +     L+ +E  G A +AAP + P A A               A AP   +  A +
Sbjct: 62  GDRLKEGDELLELEIEG-AADAAPAAAPAAAA---------------APAPAAEKPAAAE 105

Query: 125 PAPAPREAP 133
            APAP  AP
Sbjct: 106 AAPAPAAAP 114


Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 593
Number of extensions: 29
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 426
Length of database: 548
Length adjustment: 34
Effective length of query: 392
Effective length of database: 514
Effective search space:   201488
Effective search space used:   201488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory