GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Pseudomonas simiae WCS417

Align dihydrolipoyl dehydrogenase; EC 1.8.1.4 (characterized)
to candidate GFF1751 PS417_08905 dihydrolipoamide dehydrogenase

Query= CharProtDB::CH_015561
         (478 letters)



>lcl|FitnessBrowser__WCS417:GFF1751 PS417_08905 dihydrolipoamide
           dehydrogenase
          Length = 478

 Score =  845 bits (2184), Expect = 0.0
 Identities = 429/478 (89%), Positives = 450/478 (94%)

Query: 1   MTQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYTDAEGKLALGGTCLNVGCIPSKAL 60
           MTQKFDVVVIGAGPGGYVAAIKAAQLGL TACIEKYTD EGKLALGGTCLNVGCIPSKAL
Sbjct: 1   MTQKFDVVVIGAGPGGYVAAIKAAQLGLSTACIEKYTDKEGKLALGGTCLNVGCIPSKAL 60

Query: 61  LDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLTGGVATLFKANGVTSIQG 120
           LDSSWK+ EA++ F +HGI    V MDV AMVGRKA IVK LT GVATLFKANGVTS+QG
Sbjct: 61  LDSSWKFHEAQDGFAIHGIHHAGVTMDVPAMVGRKANIVKGLTSGVATLFKANGVTSLQG 120

Query: 121 HGKLLAGKKVEVTKADGTTEVIEAENVILASGSRPIDIPPAPVDQNVIVDSTGALEFQAV 180
           HGKLLAGKKVE+TK DG+TE+IEAENVILA GSRPIDIPPAPVDQNVIVDSTGALEFQAV
Sbjct: 121 HGKLLAGKKVEITKPDGSTEIIEAENVILAPGSRPIDIPPAPVDQNVIVDSTGALEFQAV 180

Query: 181 PKRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMAADTAVSKEAQKTLTKQGLDIK 240
           PKRLGVIGAGVIGLELGSVW+RLG+EVTVLEALDTFL+AADTAVSKEA KTLTKQGLDIK
Sbjct: 181 PKRLGVIGAGVIGLELGSVWSRLGSEVTVLEALDTFLLAADTAVSKEALKTLTKQGLDIK 240

Query: 241 LGARVTGSKVNGNEVEVTYTNAEGEQKITFDKLIVAVGRRPVTTDLLAADSGVTIDERGY 300
           LGARVTGSKVNG EV V YT+ +GE+ ITFDKLIVAVGRRPVTTDLLAADSGVT+DERGY
Sbjct: 241 LGARVTGSKVNGEEVVVNYTDKDGEKTITFDKLIVAVGRRPVTTDLLAADSGVTLDERGY 300

Query: 301 IFVDDYCATSVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKAQMNYDLIPSVIYTH 360
           + VDD+CAT+VPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHK QMNYDLIPSVIYTH
Sbjct: 301 VHVDDHCATTVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKTQMNYDLIPSVIYTH 360

Query: 361 PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI 420
           PEIAWVGK EQ LKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI
Sbjct: 361 PEIAWVGKNEQQLKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI 420

Query: 421 GPSAAELVQQGAIAMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHVANRKKR 478
           GP AAELVQQGAI MEFGTSAED+GMMVFSHPTLSEALHEAALAVNGGAIH+AN+KKR
Sbjct: 421 GPGAAELVQQGAIGMEFGTSAEDIGMMVFSHPTLSEALHEAALAVNGGAIHIANKKKR 478


Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 892
Number of extensions: 19
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 478
Length of database: 478
Length adjustment: 34
Effective length of query: 444
Effective length of database: 444
Effective search space:   197136
Effective search space used:   197136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

Align candidate GFF1751 PS417_08905 (dihydrolipoamide dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01350.hmm
# target sequence database:        /tmp/gapView.2530.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01350  [M=461]
Accession:   TIGR01350
Description: lipoamide_DH: dihydrolipoyl dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   3.4e-164  532.8  10.1   3.9e-164  532.6  10.1    1.0  1  lcl|FitnessBrowser__WCS417:GFF1751  PS417_08905 dihydrolipoamide deh


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF1751  PS417_08905 dihydrolipoamide dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  532.6  10.1  3.9e-164  3.9e-164       1     461 []       4     472 ..       4     472 .. 0.96

  Alignments for each domain:
  == domain 1  score: 532.6 bits;  conditional E-value: 3.9e-164
                           TIGR01350   1 eydvvviGgGpgGYvaAiraaqlglkvalvek..ek.....lGGtClnvGCiPtKalLksaevveelke.akelg 67 
                                         ++dvvviG+GpgGYvaAi+aaqlgl++a++ek  +k     lGGtClnvGCiP+KalL s+  ++e+++ ++ +g
  lcl|FitnessBrowser__WCS417:GFF1751   4 KFDVVVIGAGPGGYVAAIKAAQLGLSTACIEKytDKegklaLGGTCLNVGCIPSKALLDSSWKFHEAQDgFAIHG 78 
                                         59*****************************95421344449********************************* PP

                           TIGR01350  68 ievenvkldlekllerkekvvkklvgGvkaLlkknkvevikGeaklldkkevevkkekke.kkleakniiiAtGs 141
                                         i+ ++v++d+ +++ rk ++vk l++Gv++L+k n+v++++G++kll  k+ve++k +++ + +ea+n+i+A Gs
  lcl|FitnessBrowser__WCS417:GFF1751  79 IHHAGVTMDVPAMVGRKANIVKGLTSGVATLFKANGVTSLQGHGKLLAGKKVEITKPDGStEIIEAENVILAPGS 153
                                         *******************************************************99887799************ PP

                           TIGR01350 142 eprelplkleedekvvitseealelkevpeslvivGgGviGvEfasifaklGvkvtvielldrilpaldaevskv 216
                                         +p+ +p    +d++v+++s++ale++ vp++l ++G+GviG+E++s++++lG++vtv+e+ld+ l a d+ vsk+
  lcl|FitnessBrowser__WCS417:GFF1751 154 RPIDIPP-APVDQNVIVDSTGALEFQAVPKRLGVIGAGVIGLELGSVWSRLGSEVTVLEALDTFLLAADTAVSKE 227
                                         ******9.8999999************************************************************ PP

                           TIGR01350 217 lkkklkkkgvkiltnakvtevekeedevvveakkk.evetleaekvLvavGrkpnleelgleklgveldergaik 290
                                         + k+l+k+g++i+ +a+vt  + + +evvv+  +k  ++t++ +k++vavGr+p +++l  +  gv+lderg+++
  lcl|FitnessBrowser__WCS417:GFF1751 228 ALKTLTKQGLDIKLGARVTGSKVNGEEVVVNYTDKdGEKTITFDKLIVAVGRRPVTTDLLAADSGVTLDERGYVH 302
                                         *******************88888888886666655679************************************ PP

                           TIGR01350 291 vdeelrtnvpgiyaiGDvigklmLAhvAskegvvaaekiagkekseidykavPsviytePevasvGlteeqakee 365
                                         vd+++ t+vpg+yaiGDv++++mLAh+As+eg++++e+i g+++ +++y+++Psviyt+Pe+a vG++e+q+k+e
  lcl|FitnessBrowser__WCS417:GFF1751 303 VDDHCATTVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKT-QMNYDLIPSVIYTHPEIAWVGKNEQQLKAE 376
                                         *****************************************666.9***************************** PP

                           TIGR01350 366 gievkvgkfpfaangkalaleetdGfvkvivdkktgeilGahivgaeaseliselalaveleltveelaktihpH 440
                                         g+ev+vg fpfaa+g+a+a+++t Gfvkvi+d kt+++lG+h++g+ a+el+++ a+ +e+++++e++ ++++ H
  lcl|FitnessBrowser__WCS417:GFF1751 377 GVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVIGPGAAELVQQGAIGMEFGTSAEDIGMMVFSH 451
                                         *************************************************************************** PP

                           TIGR01350 441 PtlsEaikeaalaalgkaihv 461
                                         PtlsEa++eaala++g aih+
  lcl|FitnessBrowser__WCS417:GFF1751 452 PTLSEALHEAALAVNGGAIHI 472
                                         *******************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (461 nodes)
Target sequences:                          1  (478 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 11.45
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory