Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate GFF1730 PS417_08800 tartronate semialdehyde reductase
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__WCS417:GFF1730 Length = 296 Score = 167 bits (424), Expect = 2e-46 Identities = 99/273 (36%), Positives = 147/273 (53%), Gaps = 7/273 (2%) Query: 1 MTDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEV 60 M I F+G G MG PMAANL KAGH++ + + KA LV+ GA + Q + AE Sbjct: 1 MAKIGFIGTGIMGQPMAANLQKAGHQLFLSEHHGKAAQALVDAGAVALANPQQVAQEAEF 60 Query: 61 VISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAP 120 +I M+P V+ + DG+ A ++ ++ID S+I+P + A G LDAP Sbjct: 61 IIVMVPDTPQVDDVLFRKDGVAAGLSPNKVVIDMSSISPTATKAFAAKINETGAQYLDAP 120 Query: 121 VSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGI 180 VSGG GA+AGTLS ++GG + F RA P+ + MG+NI G +G GQ AK+ N +++ + Sbjct: 121 VSGGEVGAKAGTLSIMIGGEPQTFERALPLFQAMGKNITLVGGNGDGQTAKVANQIIVAL 180 Query: 181 LMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQ 240 + AEAL KNG DPA + E + + L ++ + + GF+ Sbjct: 181 NIQAVAEALLFASKNGADPAKVREALMGGFASSKILEVHG-------ERMIKGTFDPGFR 233 Query: 241 VRLMNKDLGLALANAQAVQASTPLGALARNLFS 273 + L KDL LALA A+ + + P A + +FS Sbjct: 234 INLHQKDLNLALAGAKELGINLPNTAGTQQVFS 266 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 296 Length adjustment: 26 Effective length of query: 272 Effective length of database: 270 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory