Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate GFF3454 PS417_17680 ABC transporter
Query= TCDB::Q8YT15 (247 letters) >FitnessBrowser__WCS417:GFF3454 Length = 231 Score = 184 bits (468), Expect = 1e-51 Identities = 96/231 (41%), Positives = 147/231 (63%), Gaps = 4/231 (1%) Query: 11 LLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKIT 70 +L VEN+H+ Y K +L+GV+ V GELVT++G NGAGK+T ++I G++ P G+I Sbjct: 1 MLIVENIHSYYDKS-HVLEGVSLTVNPGELVTLLGRNGAGKTTTLRSILGIICPRKGQIH 59 Query: 71 FKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKDKIFAMF 130 F G+ + G K +I R G+ VP+ +F L+VEENL + R S L+D ++ MF Sbjct: 60 FNGQALVGQKIFEIARQGLALVPENRGIFRLLTVEENLRIAT--RKTSRWQLED-VYGMF 116 Query: 131 PRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQIN 190 PRL +RR+ LSGGE+QMLA+ +AL+ +P LL+LDEP+ L+P++V ++ + ++++ Sbjct: 117 PRLKERRKNAGHALSGGEQQMLAIARALLNDPKLLILDEPTEGLAPVIVDELVKILRKVK 176 Query: 191 QEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYL 241 +G ++LVEQN ++ADR YVLE GR G + DP + YL Sbjct: 177 DDGLPVLLVEQNLMVCDKLADRHYVLEQGRVVYEGSAEAFRADPTIKNRYL 227 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 231 Length adjustment: 23 Effective length of query: 224 Effective length of database: 208 Effective search space: 46592 Effective search space used: 46592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory