Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 275 bits (704), Expect = 9e-79 Identities = 149/324 (45%), Positives = 207/324 (63%), Gaps = 6/324 (1%) Query: 6 ITAPVTAAPRNRLRLSLDRFGLPLVF------ILLCVVMAFSSEYFMTWRNWMDILRQTS 59 + ++ +RLRL+L R F +++ +VM +S+ F+T N +I RQ S Sbjct: 7 VNTSISTGDSSRLRLNLARLVRSPAFYPFVGLVVVTLVMILASDTFLTASNLSNIARQVS 66 Query: 60 INGILAVGMTYVILTKGIDLSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGVV 119 IN I+AVGMT VILT GIDLSVG ++A +G +A + G A+ AGM G G+ Sbjct: 67 INAIIAVGMTCVILTGGIDLSVGPVMALSGTLTAGLMVAGLPPGLAIGAGMLIGVAFGIG 126 Query: 120 NGFMVANLSIPPFVATLGMLSIARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPIII 179 NG VA L +PP + TL + IARG+ + DG PI+ LPD + G + I VPI+I Sbjct: 127 NGLFVAYLHMPPIIVTLATMGIARGLGLMYTDGYPISGLPDWFAFFGRESLFGIQVPILI 186 Query: 180 FAVVALIFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVL 239 + L+ +++L++T GRY+YA+GGNE++ R SG+ + VY +SGL A +AG+VL Sbjct: 187 MLLTYLVAYVLLQHTRIGRYIYAIGGNEEAVRLSGVRAARFKLLVYGISGLTAAIAGLVL 246 Query: 240 SARTTSALPQAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVS 299 ++R S P AGVS+ELDAIAAVV+GG S++GG G IVGTL GA+L+GV+NNGLN+LGVS Sbjct: 247 TSRLMSGQPNAGVSFELDAIAAVVLGGASIAGGRGVIVGTLLGAMLLGVLNNGLNMLGVS 306 Query: 300 SYYQQVAKGLIIVFAVLIDVWRKK 323 Y Q V KG II+ A+ I R K Sbjct: 307 PYVQSVIKGGIILLAIFISRQRHK 330 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 330 Length adjustment: 28 Effective length of query: 297 Effective length of database: 302 Effective search space: 89694 Effective search space used: 89694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory