Align SDR family oxidoreductase (characterized, see rationale)
to candidate GFF4166 PS417_21340 short-chain dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__WCS417:GFF4166 Length = 273 Score = 135 bits (339), Expect = 1e-36 Identities = 94/256 (36%), Positives = 134/256 (52%), Gaps = 15/256 (5%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASI-----AGVETHLL 61 RL GK V+IT AAQGIG A F + AR+I DI +E++A+ A + + Sbjct: 19 RLNGKVVIITGAAQGIGEAIVACFQAQQARLIIADIQGEKVEKVAAHWRERGADIYAQAV 78 Query: 62 DVTDDDAIKALV----AKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTI 117 D+T D +ALV + G VDVL NCAG + LE D+ W F ++ + Sbjct: 79 DITSKDQWQALVNLAIERFGRVDVLVNCAGVNVFRDPLEMTDEDWRRCFAIDLDGAWFGC 138 Query: 118 RAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCN 177 RAVLP M+ + G+I+NIAS SS + F Y +K ++GLT+++ ++ +GIR N Sbjct: 139 RAVLPHMIEQGIGNIINIASTHSS-HIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVN 197 Query: 178 AICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDE 237 AI PG IE+ +++ R P RIG+ EVA AL+LA+DE Sbjct: 198 AIAPGYIET-----QLNVDYWNGFPDPHAERQRAFDLHPPKRIGQPIEVAMTALFLATDE 252 Query: 238 SNFTTGSIHMIDGGWS 253 + F + MIDGG S Sbjct: 253 APFINATCLMIDGGRS 268 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 273 Length adjustment: 25 Effective length of query: 229 Effective length of database: 248 Effective search space: 56792 Effective search space used: 56792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory